Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q8N6T3

- ARFG1_HUMAN

UniProt

Q8N6T3 - ARFG1_HUMAN

Protein

ADP-ribosylation factor GTPase-activating protein 1

Gene

ARFGAP1

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 125 (01 Oct 2014)
      Sequence version 2 (27 Jan 2003)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    GTPase-activating protein (GAP) for the ADP ribosylation factor 1 (ARF1). Involved in membrane trafficking and /or vesicle transport. Promotes hydrolysis of the ARF1-bound GTP and thus, is required for the dissociation of coat proteins from Golgi-derived membranes and vesicles, a prerequisite for vesicle's fusion with target compartment. Probably regulates ARF1-mediated transport via its interaction with the KDELR proteins and TMED2. Overexpression induces the redistribution of the entire Golgi complex to the endoplasmic reticulum, as when ARF1 is deactivated. Its activity is stimulated by phosphoinosides and inhibited by phosphatidylcholine By similarity.By similarity

    Regions

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Zinc fingeri22 – 4524C4-typePROSITE-ProRule annotationAdd
    BLAST

    GO - Molecular functioni

    1. ARF GTPase activator activity Source: InterPro
    2. GTPase activator activity Source: MGI
    3. protein binding Source: IntAct
    4. zinc ion binding Source: InterPro

    GO - Biological processi

    1. activation of signaling protein activity involved in unfolded protein response Source: Reactome
    2. cellular protein metabolic process Source: Reactome
    3. COPI coating of Golgi vesicle Source: Reactome
    4. endoplasmic reticulum unfolded protein response Source: Reactome
    5. membrane organization Source: Reactome
    6. positive regulation of GTPase activity Source: GOC
    7. protein transport Source: UniProtKB-KW
    8. regulation of ARF GTPase activity Source: InterPro
    9. retrograde vesicle-mediated transport, Golgi to ER Source: Reactome

    Keywords - Molecular functioni

    GTPase activation

    Keywords - Biological processi

    ER-Golgi transport, Protein transport, Transport

    Keywords - Ligandi

    Metal-binding, Zinc

    Enzyme and pathway databases

    ReactomeiREACT_11096. COPI Mediated Transport.
    REACT_18273. XBP1(S) activates chaperone genes.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    ADP-ribosylation factor GTPase-activating protein 1
    Short name:
    ARF GAP 1
    Alternative name(s):
    ADP-ribosylation factor 1 GTPase-activating protein
    Short name:
    ARF1 GAP
    ARF1-directed GTPase-activating protein
    Gene namesi
    Name:ARFGAP1
    Synonyms:ARF1GAP
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 20

    Organism-specific databases

    HGNCiHGNC:15852. ARFGAP1.

    Subcellular locationi

    Cytoplasm By similarity. Golgi apparatus By similarity
    Note: Associates with the Golgi complex.By similarity

    GO - Cellular componenti

    1. cytosol Source: Reactome
    2. Golgi-associated vesicle membrane Source: Reactome
    3. synapse Source: Ensembl

    Keywords - Cellular componenti

    Cytoplasm, Golgi apparatus

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA164741246.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 406406ADP-ribosylation factor GTPase-activating protein 1PRO_0000074190Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei135 – 1351Phosphothreonine2 Publications
    Modified residuei189 – 1891Phosphothreonine3 Publications
    Modified residuei231 – 2311N6-acetyllysine1 Publication
    Modified residuei304 – 3041Phosphoserine1 Publication

    Keywords - PTMi

    Acetylation, Phosphoprotein

    Proteomic databases

    MaxQBiQ8N6T3.
    PaxDbiQ8N6T3.
    PRIDEiQ8N6T3.

    PTM databases

    PhosphoSiteiQ8N6T3.

    Expressioni

    Gene expression databases

    ArrayExpressiQ8N6T3.
    BgeeiQ8N6T3.
    CleanExiHS_ARFGAP1.
    GenevestigatoriQ8N6T3.

    Organism-specific databases

    HPAiHPA051019.
    HPA056273.

    Interactioni

    Subunit structurei

    Interacts with ARF1. Interacts with the COPI coat proteins, KDELR1 and TMED2. The interaction with TMED2 inhibits the GAP activity By similarity.By similarity

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    LRRK2Q5S0076EBI-6288865,EBI-5323863

    Protein-protein interaction databases

    BioGridi120856. 24 interactions.
    IntActiQ8N6T3. 19 interactions.
    MINTiMINT-1409968.
    STRINGi9606.ENSP00000314615.

    Structurei

    Secondary structure

    1
    406
    Legend: HelixTurnBeta strand
    Show more details
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Helixi4 – 1411
    Turni17 – 204
    Turni23 – 253
    Beta strandi32 – 343
    Turni35 – 384
    Beta strandi39 – 413
    Helixi43 – 5210
    Turni54 – 563
    Beta strandi59 – 624
    Helixi69 – 779
    Helixi80 – 889
    Helixi99 – 1035
    Helixi106 – 11914

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    EntryMethodResolution (Å)ChainPositionsPDBsum
    3DWDX-ray2.40A/B1-128[»]
    3O47X-ray2.80A/B1-140[»]
    ProteinModelPortaliQ8N6T3.
    SMRiQ8N6T3. Positions 3-153.
    ModBaseiSearch...
    MobiDBiSearch...

    Miscellaneous databases

    EvolutionaryTraceiQ8N6T3.

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini7 – 124118Arf-GAPPROSITE-ProRule annotationAdd
    BLAST

    Domaini

    The region downstream of Arf-GAP domain is essential to GAP activity in vivo. This region may be required for its targeting to Golgi membranes By similarity.By similarity

    Sequence similaritiesi

    Contains 1 Arf-GAP domain.PROSITE-ProRule annotation

    Zinc finger

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Zinc fingeri22 – 4524C4-typePROSITE-ProRule annotationAdd
    BLAST

    Keywords - Domaini

    Zinc-finger

    Phylogenomic databases

    eggNOGiCOG5347.
    HOGENOMiHOG000008494.
    HOVERGENiHBG050562.
    KOiK12492.
    OMAiSDSWENW.
    OrthoDBiEOG7C8GH3.
    PhylomeDBiQ8N6T3.
    TreeFamiTF105931.

    Family and domain databases

    InterProiIPR001164. ArfGAP.
    [Graphical view]
    PfamiPF01412. ArfGap. 1 hit.
    [Graphical view]
    PRINTSiPR00405. REVINTRACTNG.
    SMARTiSM00105. ArfGap. 1 hit.
    [Graphical view]
    PROSITEiPS50115. ARFGAP. 1 hit.
    [Graphical view]

    Sequences (5)i

    Sequence statusi: Complete.

    This entry describes 5 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q8N6T3-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MASPRTRKVL KEVRVQDENN VCFECGAFNP QWVSVTYGIW ICLECSGRHR    50
    GLGVHLSFVR SVTMDKWKDI ELEKMKAGGN AKFREFLESQ EDYDPCWSLQ 100
    EKYNSRAAAL FRDKVVALAE GREWSLESSP AQNWTPPQPR TLPSMVHRVS 150
    GQPQSVTASS DKAFEDWLND DLGSYQGAQG NRYVGFGNTP PPQKKEDDFL 200
    NNAMSSLYSG WSSFTTGASR FASAAKEGAT KFGSQASQKA SELGHSLNEN 250
    VLKPAQEKVK EGKIFDDVSS GVSQLASKVQ GVGSKGWRDV TTFFSGKAEG 300
    PLDSPSEGHS YQNSGLDHFQ NSNIDQSFWE TFGSAEPTKT RKSPSSDSWT 350
    CADTSTERRS SDSWEVWGSA STNRNSNSDG GEGGEGTKKA VPPAVPTDDG 400
    WDNQNW 406
    Length:406
    Mass (Da):44,668
    Last modified:January 27, 2003 - v2
    Checksum:iCAE41828DE660621
    GO
    Isoform 2 (identifier: Q8N6T3-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         239-239: K → KFWGHKQQPEP
         279-280: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:414
    Mass (Da):45,676
    Checksum:iBD081C6CE6CF0A18
    GO
    Isoform 3 (identifier: Q8N6T3-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         279-406: VQGVGSKGWR...TDDGWDNQNW → CQRRLCCHQS...AVWTTSKTAT

    Show »
    Length:403
    Mass (Da):44,467
    Checksum:i0C695741E21D0F6F
    GO
    Isoform 4 (identifier: Q8N6T3-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-34: MASPRTRKVLKEVRVQDENNVCFECGAFNPQWVS → MLSSESSWSLRRITILAGPCRRSTTAEPRPSLGI
         35-147: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:293
    Mass (Da):31,476
    Checksum:iC0EEFC7461FF6CB3
    GO
    Isoform 5 (identifier: Q8N6T3-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-57: MASPRTRKVLKEVRVQDENNVCFECGAFNPQWVSVTYGIWICLECSGRHRGLGVHLS → MRTT
         239-239: K → KFWGHKQQPEP
         279-280: Missing.

    Show »
    Length:361
    Mass (Da):39,705
    Checksum:iD34FF3C257C7E8FB
    GO

    Sequence cautioni

    The sequence CAB70901.1 differs from that shown. Reason: Intron retention.
    The sequence BAB55009.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.
    The sequence BAB55113.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti274 – 2741Q → R in BAB55009. (PubMed:14702039)Curated
    Sequence conflicti358 – 3581R → G in BAH12326. (PubMed:14702039)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti184 – 1841V → M.
    Corresponds to variant rs2273499 [ dbSNP | Ensembl ].
    VAR_015187

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 5757MASPR…GVHLS → MRTT in isoform 5. 1 PublicationVSP_055739Add
    BLAST
    Alternative sequencei1 – 3434MASPR…PQWVS → MLSSESSWSLRRITILAGPC RRSTTAEPRPSLGI in isoform 4. 1 PublicationVSP_055379Add
    BLAST
    Alternative sequencei35 – 147113Missing in isoform 4. 1 PublicationVSP_055380Add
    BLAST
    Alternative sequencei239 – 2391K → KFWGHKQQPEP in isoform 2 and isoform 5. 2 PublicationsVSP_000298
    Alternative sequencei279 – 406128VQGVG…DNQNW → CQRRLCCHQSHCSAGHLGRA FCPVSWHEALCGQTGREEQA SLLPPKHVVGALEVCARGCP RCHVPHTPGTAAEWPGRLCL SRESVVRDGGTSPPFFRGKQ RAPWTAPRRATVIRTAVWTT SKTAT in isoform 3. 1 PublicationVSP_021818Add
    BLAST
    Alternative sequencei279 – 2802Missing in isoform 2 and isoform 5. 2 PublicationsVSP_000299

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK001629 mRNA. Translation: BAA91796.1.
    AK027268 mRNA. Translation: BAB55009.1. Different initiation.
    AK296351 mRNA. Translation: BAH12326.1.
    AK027441 mRNA. Translation: BAB55113.1. Different initiation.
    AK303454 mRNA. Translation: BAH13964.1.
    AL121827 Genomic DNA. Translation: CAX12645.1.
    CH471077 Genomic DNA. Translation: EAW75292.1.
    CH471077 Genomic DNA. Translation: EAW75294.1.
    BC000786 mRNA. Translation: AAH00786.1.
    BC006085 mRNA. Translation: AAH06085.1.
    BC011876 mRNA. Translation: AAH11876.1.
    BC028233 mRNA. Translation: AAH28233.1.
    AL137744 mRNA. Translation: CAB70901.1. Sequence problems.
    AB015340 mRNA. Translation: BAA88117.1.
    CCDSiCCDS13515.1. [Q8N6T3-1]
    CCDS13516.1. [Q8N6T3-2]
    CCDS63326.1. [Q8N6T3-3]
    CCDS63328.1. [Q8N6T3-4]
    PIRiT46298.
    RefSeqiNP_001268411.1. NM_001281482.1. [Q8N6T3-3]
    NP_001268412.1. NM_001281483.1.
    NP_001268413.1. NM_001281484.1.
    NP_060679.1. NM_018209.3. [Q8N6T3-1]
    NP_783202.1. NM_175609.2. [Q8N6T3-2]
    UniGeneiHs.25584.

    Genome annotation databases

    EnsembliENST00000353546; ENSP00000314615; ENSG00000101199. [Q8N6T3-2]
    ENST00000370275; ENSP00000359298; ENSG00000101199. [Q8N6T3-3]
    ENST00000370283; ENSP00000359306; ENSG00000101199. [Q8N6T3-1]
    ENST00000519273; ENSP00000443716; ENSG00000101199. [Q8N6T3-4]
    ENST00000519604; ENSP00000430500; ENSG00000101199. [Q8N6T3-5]
    GeneIDi55738.
    KEGGihsa:55738.
    UCSCiuc002yel.3. human. [Q8N6T3-2]
    uc002yem.3. human. [Q8N6T3-1]

    Polymorphism databases

    DMDMi27923731.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK001629 mRNA. Translation: BAA91796.1 .
    AK027268 mRNA. Translation: BAB55009.1 . Different initiation.
    AK296351 mRNA. Translation: BAH12326.1 .
    AK027441 mRNA. Translation: BAB55113.1 . Different initiation.
    AK303454 mRNA. Translation: BAH13964.1 .
    AL121827 Genomic DNA. Translation: CAX12645.1 .
    CH471077 Genomic DNA. Translation: EAW75292.1 .
    CH471077 Genomic DNA. Translation: EAW75294.1 .
    BC000786 mRNA. Translation: AAH00786.1 .
    BC006085 mRNA. Translation: AAH06085.1 .
    BC011876 mRNA. Translation: AAH11876.1 .
    BC028233 mRNA. Translation: AAH28233.1 .
    AL137744 mRNA. Translation: CAB70901.1 . Sequence problems.
    AB015340 mRNA. Translation: BAA88117.1 .
    CCDSi CCDS13515.1. [Q8N6T3-1 ]
    CCDS13516.1. [Q8N6T3-2 ]
    CCDS63326.1. [Q8N6T3-3 ]
    CCDS63328.1. [Q8N6T3-4 ]
    PIRi T46298.
    RefSeqi NP_001268411.1. NM_001281482.1. [Q8N6T3-3 ]
    NP_001268412.1. NM_001281483.1.
    NP_001268413.1. NM_001281484.1.
    NP_060679.1. NM_018209.3. [Q8N6T3-1 ]
    NP_783202.1. NM_175609.2. [Q8N6T3-2 ]
    UniGenei Hs.25584.

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    Entry Method Resolution (Å) Chain Positions PDBsum
    3DWD X-ray 2.40 A/B 1-128 [» ]
    3O47 X-ray 2.80 A/B 1-140 [» ]
    ProteinModelPortali Q8N6T3.
    SMRi Q8N6T3. Positions 3-153.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 120856. 24 interactions.
    IntActi Q8N6T3. 19 interactions.
    MINTi MINT-1409968.
    STRINGi 9606.ENSP00000314615.

    PTM databases

    PhosphoSitei Q8N6T3.

    Polymorphism databases

    DMDMi 27923731.

    Proteomic databases

    MaxQBi Q8N6T3.
    PaxDbi Q8N6T3.
    PRIDEi Q8N6T3.

    Protocols and materials databases

    DNASUi 55738.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000353546 ; ENSP00000314615 ; ENSG00000101199 . [Q8N6T3-2 ]
    ENST00000370275 ; ENSP00000359298 ; ENSG00000101199 . [Q8N6T3-3 ]
    ENST00000370283 ; ENSP00000359306 ; ENSG00000101199 . [Q8N6T3-1 ]
    ENST00000519273 ; ENSP00000443716 ; ENSG00000101199 . [Q8N6T3-4 ]
    ENST00000519604 ; ENSP00000430500 ; ENSG00000101199 . [Q8N6T3-5 ]
    GeneIDi 55738.
    KEGGi hsa:55738.
    UCSCi uc002yel.3. human. [Q8N6T3-2 ]
    uc002yem.3. human. [Q8N6T3-1 ]

    Organism-specific databases

    CTDi 55738.
    GeneCardsi GC20P061904.
    H-InvDB HIX0174713.
    HGNCi HGNC:15852. ARFGAP1.
    HPAi HPA051019.
    HPA056273.
    MIMi 608377. gene.
    neXtProti NX_Q8N6T3.
    PharmGKBi PA164741246.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG5347.
    HOGENOMi HOG000008494.
    HOVERGENi HBG050562.
    KOi K12492.
    OMAi SDSWENW.
    OrthoDBi EOG7C8GH3.
    PhylomeDBi Q8N6T3.
    TreeFami TF105931.

    Enzyme and pathway databases

    Reactomei REACT_11096. COPI Mediated Transport.
    REACT_18273. XBP1(S) activates chaperone genes.

    Miscellaneous databases

    ChiTaRSi ARFGAP1. human.
    EvolutionaryTracei Q8N6T3.
    GeneWikii ARFGAP1.
    GenomeRNAii 55738.
    NextBioi 35480485.
    PROi Q8N6T3.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q8N6T3.
    Bgeei Q8N6T3.
    CleanExi HS_ARFGAP1.
    Genevestigatori Q8N6T3.

    Family and domain databases

    InterProi IPR001164. ArfGAP.
    [Graphical view ]
    Pfami PF01412. ArfGap. 1 hit.
    [Graphical view ]
    PRINTSi PR00405. REVINTRACTNG.
    SMARTi SM00105. ArfGap. 1 hit.
    [Graphical view ]
    PROSITEi PS50115. ARFGAP. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 4 AND 5).
      Tissue: Thymus.
    2. "The DNA sequence and comparative analysis of human chromosome 20."
      Deloukas P., Matthews L.H., Ashurst J.L., Burton J., Gilbert J.G.R., Jones M., Stavrides G., Almeida J.P., Babbage A.K., Bagguley C.L., Bailey J., Barlow K.F., Bates K.N., Beard L.M., Beare D.M., Beasley O.P., Bird C.P., Blakey S.E.
      , Bridgeman A.M., Brown A.J., Buck D., Burrill W.D., Butler A.P., Carder C., Carter N.P., Chapman J.C., Clamp M., Clark G., Clark L.N., Clark S.Y., Clee C.M., Clegg S., Cobley V.E., Collier R.E., Connor R.E., Corby N.R., Coulson A., Coville G.J., Deadman R., Dhami P.D., Dunn M., Ellington A.G., Frankland J.A., Fraser A., French L., Garner P., Grafham D.V., Griffiths C., Griffiths M.N.D., Gwilliam R., Hall R.E., Hammond S., Harley J.L., Heath P.D., Ho S., Holden J.L., Howden P.J., Huckle E., Hunt A.R., Hunt S.E., Jekosch K., Johnson C.M., Johnson D., Kay M.P., Kimberley A.M., King A., Knights A., Laird G.K., Lawlor S., Lehvaeslaiho M.H., Leversha M.A., Lloyd C., Lloyd D.M., Lovell J.D., Marsh V.L., Martin S.L., McConnachie L.J., McLay K., McMurray A.A., Milne S.A., Mistry D., Moore M.J.F., Mullikin J.C., Nickerson T., Oliver K., Parker A., Patel R., Pearce T.A.V., Peck A.I., Phillimore B.J.C.T., Prathalingam S.R., Plumb R.W., Ramsay H., Rice C.M., Ross M.T., Scott C.E., Sehra H.K., Shownkeen R., Sims S., Skuce C.D., Smith M.L., Soderlund C., Steward C.A., Sulston J.E., Swann R.M., Sycamore N., Taylor R., Tee L., Thomas D.W., Thorpe A., Tracey A., Tromans A.C., Vaudin M., Wall M., Wallis J.M., Whitehead S.L., Whittaker P., Willey D.L., Williams L., Williams S.A., Wilming L., Wray P.W., Hubbard T., Durbin R.M., Bentley D.R., Beck S., Rogers J.
      Nature 414:865-871(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3).
      Tissue: Brain and Fetal brain.
    5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 240-406 (ISOFORM 1).
      Tissue: Testis.
    6. "HRI NTT human fetal brain cDNA project."
      Ueki N.
      Submitted (JUN-1998) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 299-406 (ISOFORM 1).
      Tissue: Fetal brain.
    7. "A probability-based approach for high-throughput protein phosphorylation analysis and site localization."
      Beausoleil S.A., Villen J., Gerber S.A., Rush J., Gygi S.P.
      Nat. Biotechnol. 24:1285-1292(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-189, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    8. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-135 AND SER-304, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    9. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
      Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
      Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-189, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Leukemic T-cell.
    10. "Lysine acetylation targets protein complexes and co-regulates major cellular functions."
      Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.C., Olsen J.V., Mann M.
      Science 325:834-840(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-231, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    11. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
      Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
      Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-135 AND THR-189, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    12. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    13. "Crystal structure of the ARFGAP domain of human ARFGAP1."
      Structural genomics consortium (SGC)
      Submitted (FEB-2009) to the PDB data bank
      Cited for: X-RAY CRYSTALLOGRAPHY (2.4 ANGSTROMS) OF 1-128 IN COMPLEX WITH ZINC IONS.

    Entry informationi

    Entry nameiARFG1_HUMAN
    AccessioniPrimary (citable) accession number: Q8N6T3
    Secondary accession number(s): B7Z3U0
    , B7Z8H8, B7ZBI3, E1P5I9, E7EV62, Q6PK71, Q96KC4, Q96T02, Q9NSU3, Q9NVF6, Q9UIL0
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: January 27, 2003
    Last sequence update: January 27, 2003
    Last modified: October 1, 2014
    This is version 125 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    3D-structure, Complete proteome, Reference proteome

    Documents

    1. Human chromosome 20
      Human chromosome 20: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    6. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3