Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Ankyrin repeat domain-containing protein 13C

Gene

ANKRD13C

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at transcript leveli

Functioni

Acts as a molecular chaperone for G protein-coupled receptors, regulating their biogenesis and exit from the ER.1 Publication

GO - Molecular functioni

  • receptor binding Source: BHF-UCL

GO - Biological processi

  • protein retention in ER lumen Source: BHF-UCL
  • regulation of anoikis Source: BHF-UCL
  • regulation of receptor biosynthetic process Source: BHF-UCL
Complete GO annotation...

Keywords - Molecular functioni

Chaperone

Names & Taxonomyi

Protein namesi
Recommended name:
Ankyrin repeat domain-containing protein 13C
Gene namesi
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

HGNCiHGNC:25374. ANKRD13C.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Endoplasmic reticulum, Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA142672617.

Polymorphism and mutation databases

BioMutaiANKRD13C.
DMDMi109940205.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 541541Ankyrin repeat domain-containing protein 13CPRO_0000240645Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei411 – 4111PhosphoserineBy similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ8N6S4.
PaxDbiQ8N6S4.
PRIDEiQ8N6S4.

PTM databases

iPTMnetiQ8N6S4.
PhosphoSiteiQ8N6S4.

Expressioni

Gene expression databases

BgeeiQ8N6S4.
CleanExiHS_ANKRD13C.
GenevisibleiQ8N6S4. HS.

Organism-specific databases

HPAiHPA026725.
HPA026766.

Interactioni

GO - Molecular functioni

  • receptor binding Source: BHF-UCL

Protein-protein interaction databases

BioGridi123534. 9 interactions.
MINTiMINT-3040699.
STRINGi9606.ENSP00000359982.

Structurei

3D structure databases

ProteinModelPortaliQ8N6S4.
SMRiQ8N6S4. Positions 79-199.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Repeati111 – 14232ANK 1Add
BLAST
Repeati143 – 17230ANK 2Add
BLAST
Repeati176 – 20530ANK 3Add
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi30 – 334Poly-Ala

Sequence similaritiesi

Contains 3 ANK repeats.PROSITE-ProRule annotation

Keywords - Domaini

ANK repeat, Repeat

Phylogenomic databases

eggNOGiKOG0522. Eukaryota.
ENOG410XNMS. LUCA.
GeneTreeiENSGT00410000025381.
HOGENOMiHOG000007095.
HOVERGENiHBG101623.
InParanoidiQ8N6S4.
OMAiSDACKIH.
OrthoDBiEOG7HF1J2.
PhylomeDBiQ8N6S4.
TreeFamiTF314176.

Family and domain databases

Gene3Di1.25.40.20. 1 hit.
InterProiIPR021832. ANKRD13.
IPR002110. Ankyrin_rpt.
IPR020683. Ankyrin_rpt-contain_dom.
[Graphical view]
PANTHERiPTHR12447. PTHR12447. 1 hit.
PfamiPF12796. Ank_2. 1 hit.
PF11904. GPCR_chapero_1. 1 hit.
[Graphical view]
SMARTiSM00248. ANK. 2 hits.
[Graphical view]
SUPFAMiSSF48403. SSF48403. 1 hit.
PROSITEiPS50297. ANK_REP_REGION. 1 hit.
PS50088. ANK_REPEAT. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8N6S4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MTGEKIRSLR RDHKPSKEEG DLLEPGDEEA AAALGGTFTR SRIGKGGKAC
60 70 80 90 100
HKIFSNHHHR LQLKAAPASS NPPGAPALPL HNSSVTANSQ SPALLAGTNP
110 120 130 140 150
VAVVADGGSC PAHYPVHECV FKGDVRRLSS LIRTHNIGQK DNHGNTPLHL
160 170 180 190 200
AVMLGNKECA HLLLAHNAPV KVKNAQGWSP LAEAISYGDR QMITALLRKL
210 220 230 240 250
KQQSRESVEE KRPRLLKALK ELGDFYLELH WDFQSWVPLL SRILPSDACK
260 270 280 290 300
IYKQGINIRL DTTLIDFTDM KCQRGDLSFI FNGDAAPSES FVVLDNEQKV
310 320 330 340 350
YQRIHHEESE METEEEVDIL MSSDIYSATL STKSISFTRA QTGWLFREDK
360 370 380 390 400
TERVGNFLAD FYLVNGLVLE SRKRREHLSE EDILRNKAIM ESLSKGGNIM
410 420 430 440 450
EQNFEPIRRQ SLTPPPQNTI TWEEYISAEN GKAPHLGREL VCKESKKTFK
460 470 480 490 500
ATIAMSQEFP LGIELLLNVL EVVAPFKHFN KLREFVQMKL PPGFPVKLDI
510 520 530 540
PVFPTITATV TFQEFRYDEF DGSIFTIPDD YKEDPSRFPD L
Length:541
Mass (Da):60,818
Last modified:June 27, 2006 - v2
Checksum:i0215707FDFB92046
GO
Isoform 2 (identifier: Q8N6S4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     158-193: ECAHLLLAHNAPVKVKNAQGWSPLAEAISYGDRQMI → V

Note: No experimental confirmation available.
Show »
Length:506
Mass (Da):57,003
Checksum:iC907ED83B395E6BB
GO
Isoform 3 (identifier: Q8N6S4-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     145-147: NTP → EEC
     148-541: Missing.

Note: No experimental confirmation available.
Show »
Length:147
Mass (Da):15,550
Checksum:iCC81CA5B6D459960
GO

Sequence cautioni

The sequence BAG51959.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti369 – 3691L → I in CAB66651 (PubMed:11230166).Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti413 – 4131T → S.1 Publication
Corresponds to variant rs17852616 [ dbSNP | Ensembl ].
VAR_026825

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei145 – 1473NTP → EEC in isoform 3. 1 PublicationVSP_019406
Alternative sequencei148 – 541394Missing in isoform 3. 1 PublicationVSP_019407Add
BLAST
Alternative sequencei158 – 19336ECAHL…DRQMI → V in isoform 2. 1 PublicationVSP_019408Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AL136717 mRNA. Translation: CAB66651.1.
AL158839, AL353771, AL354721 Genomic DNA. Translation: CAH70969.1.
AL158839, AL353771, AL354721 Genomic DNA. Translation: CAH70970.1.
AL354721, AL158839, AL353771 Genomic DNA. Translation: CAH73081.1.
AL354721, AL158839, AL353771 Genomic DNA. Translation: CAH73082.1.
AL353771, AL158839, AL354721 Genomic DNA. Translation: CAI22330.1.
AL353771, AL158839, AL354721 Genomic DNA. Translation: CAI22331.1.
BC016937 mRNA. Translation: AAH16937.1.
BC028840 mRNA. Translation: AAH28840.1.
AK074187 mRNA. Translation: BAG51959.1. Different initiation.
CCDSiCCDS648.2. [Q8N6S4-1]
RefSeqiNP_110443.3. NM_030816.4. [Q8N6S4-1]
UniGeneiHs.744989.

Genome annotation databases

EnsembliENST00000262346; ENSP00000262346; ENSG00000118454. [Q8N6S4-2]
ENST00000370944; ENSP00000359982; ENSG00000118454. [Q8N6S4-1]
GeneIDi81573.
KEGGihsa:81573.
UCSCiuc001dex.5. human. [Q8N6S4-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AL136717 mRNA. Translation: CAB66651.1.
AL158839, AL353771, AL354721 Genomic DNA. Translation: CAH70969.1.
AL158839, AL353771, AL354721 Genomic DNA. Translation: CAH70970.1.
AL354721, AL158839, AL353771 Genomic DNA. Translation: CAH73081.1.
AL354721, AL158839, AL353771 Genomic DNA. Translation: CAH73082.1.
AL353771, AL158839, AL354721 Genomic DNA. Translation: CAI22330.1.
AL353771, AL158839, AL354721 Genomic DNA. Translation: CAI22331.1.
BC016937 mRNA. Translation: AAH16937.1.
BC028840 mRNA. Translation: AAH28840.1.
AK074187 mRNA. Translation: BAG51959.1. Different initiation.
CCDSiCCDS648.2. [Q8N6S4-1]
RefSeqiNP_110443.3. NM_030816.4. [Q8N6S4-1]
UniGeneiHs.744989.

3D structure databases

ProteinModelPortaliQ8N6S4.
SMRiQ8N6S4. Positions 79-199.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi123534. 9 interactions.
MINTiMINT-3040699.
STRINGi9606.ENSP00000359982.

PTM databases

iPTMnetiQ8N6S4.
PhosphoSiteiQ8N6S4.

Polymorphism and mutation databases

BioMutaiANKRD13C.
DMDMi109940205.

Proteomic databases

MaxQBiQ8N6S4.
PaxDbiQ8N6S4.
PRIDEiQ8N6S4.

Protocols and materials databases

DNASUi81573.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000262346; ENSP00000262346; ENSG00000118454. [Q8N6S4-2]
ENST00000370944; ENSP00000359982; ENSG00000118454. [Q8N6S4-1]
GeneIDi81573.
KEGGihsa:81573.
UCSCiuc001dex.5. human. [Q8N6S4-1]

Organism-specific databases

CTDi81573.
GeneCardsiANKRD13C.
H-InvDBHIX0000694.
HGNCiHGNC:25374. ANKRD13C.
HPAiHPA026725.
HPA026766.
MIMi615125. gene.
neXtProtiNX_Q8N6S4.
PharmGKBiPA142672617.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0522. Eukaryota.
ENOG410XNMS. LUCA.
GeneTreeiENSGT00410000025381.
HOGENOMiHOG000007095.
HOVERGENiHBG101623.
InParanoidiQ8N6S4.
OMAiSDACKIH.
OrthoDBiEOG7HF1J2.
PhylomeDBiQ8N6S4.
TreeFamiTF314176.

Miscellaneous databases

GeneWikiiANKRD13C.
GenomeRNAii81573.
PROiQ8N6S4.
SOURCEiSearch...

Gene expression databases

BgeeiQ8N6S4.
CleanExiHS_ANKRD13C.
GenevisibleiQ8N6S4. HS.

Family and domain databases

Gene3Di1.25.40.20. 1 hit.
InterProiIPR021832. ANKRD13.
IPR002110. Ankyrin_rpt.
IPR020683. Ankyrin_rpt-contain_dom.
[Graphical view]
PANTHERiPTHR12447. PTHR12447. 1 hit.
PfamiPF12796. Ank_2. 1 hit.
PF11904. GPCR_chapero_1. 1 hit.
[Graphical view]
SMARTiSM00248. ANK. 2 hits.
[Graphical view]
SUPFAMiSSF48403. SSF48403. 1 hit.
PROSITEiPS50297. ANK_REP_REGION. 1 hit.
PS50088. ANK_REPEAT. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Kidney.
  2. "The DNA sequence and biological annotation of human chromosome 1."
    Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K.
    , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
    Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3), VARIANT SER-413.
    Tissue: Colon and Eye.
  4. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 352-541 (ISOFORM 1).
    Tissue: Teratocarcinoma.
  5. Cited for: FUNCTION, SUBCELLULAR LOCATION.

Entry informationi

Entry nameiAN13C_HUMAN
AccessioniPrimary (citable) accession number: Q8N6S4
Secondary accession number(s): B3KQ97
, Q5VYH4, Q5VYH5, Q6PJE4, Q9H0N9
Entry historyi
Integrated into UniProtKB/Swiss-Prot: June 27, 2006
Last sequence update: June 27, 2006
Last modified: June 8, 2016
This is version 112 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.