Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q8N668

- COMD1_HUMAN

UniProt

Q8N668 - COMD1_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

COMM domain-containing protein 1

Gene

COMMD1

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Promotes ubiquitination of NF-kappa-B subunit RELA and its subsequent proteasomal degradation. Down-regulates NF-kappa-B activity. Down-regulates SOD1 activity by interfering with its homodimerization. Plays a role in copper ion homeostasis. Can bind one copper ion per monomer. May function to facilitate biliary copper excretion within hepatocytes.7 Publications

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Metal bindingi101 – 1011CopperSequence Analysis
Metal bindingi110 – 1101CopperSequence Analysis
Metal bindingi134 – 1341CopperSequence Analysis

GO - Molecular functioni

  1. copper ion binding Source: UniProtKB
  2. identical protein binding Source: IntAct
  3. protein homodimerization activity Source: UniProtKB

GO - Biological processi

  1. copper ion homeostasis Source: UniProtKB
  2. negative regulation of NF-kappaB transcription factor activity Source: UniProtKB
  3. positive regulation of protein ubiquitination Source: UniProtKB
  4. regulation of proteasomal ubiquitin-dependent protein catabolic process Source: UniProtKB
Complete GO annotation...

Keywords - Biological processi

Ubl conjugation pathway

Keywords - Ligandi

Copper, Metal-binding

Names & Taxonomyi

Protein namesi
Recommended name:
COMM domain-containing protein 1
Alternative name(s):
Protein Murr1
Gene namesi
Name:COMMD1
Synonyms:C2orf5, MURR1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 2

Organism-specific databases

HGNCiHGNC:23024. COMMD1.

Subcellular locationi

Nucleus. Cytoplasm
Note: Shuttles between nucleus and cytosol. Detected in perinuclear foci that may be aggresomes containing misfolded, ubiquitinated proteins.

GO - Cellular componenti

  1. Cul2-RING ubiquitin ligase complex Source: UniProtKB
  2. cytoplasm Source: UniProtKB
  3. extracellular vesicular exosome Source: UniProt
  4. nucleus Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi110 – 1101M → A: Reduces copper-induced fluorescence change. 1 Publication
Mutagenesisi134 – 1341H → A: Reduces copper-induced fluorescence change. 1 Publication

Organism-specific databases

PharmGKBiPA134891368.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Initiator methioninei1 – 11Removed1 Publication
Chaini2 – 190189COMM domain-containing protein 1PRO_0000077384Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei2 – 21N-acetylalanine1 Publication

Post-translational modificationi

Ubiquitinated; undergoes both 'Lys-63'- and 'Lys-48'-linked polyubiquitination. Ubiquitinated by XIAP, leading to its proteasomal degradation.3 Publications

Keywords - PTMi

Acetylation, Ubl conjugation

Proteomic databases

MaxQBiQ8N668.
PaxDbiQ8N668.
PRIDEiQ8N668.

PTM databases

PhosphoSiteiQ8N668.

Expressioni

Tissue specificityi

Ubiquitous. Highest expression in the liver, with lower expression in brain, lung, placenta, pancreas, small intestine, heart, skeletal muscle, kidney and placenta.3 Publications

Gene expression databases

BgeeiQ8N668.
CleanExiHS_COMMD1.
ExpressionAtlasiQ8N668. baseline and differential.
GenevestigatoriQ8N668.

Organism-specific databases

HPAiHPA034633.

Interactioni

Subunit structurei

Monomer and homodimer. Interacts (via COMM domain) with COMMD2, COMMD3, COMMD4, COMMD5, COMMD6, COMMD7, COMMD8 and COMMD10 (via COMM domain). Identified in a complex with an E3 ubiquitin ligase complex composed of TCEB1/elongin C, CUL2, SOCS1 and RBX1. Interacts directly with SOCS1 and CUL2. Interacts directly the N-terminal region of ATP7B. Interacts with CCS, CDKN2A, RELA and NFKBIB. Identified in a complex with NF-kappa-B. Interacts with CLU.9 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
itself2EBI-1550112,EBI-1550112
COMMD3Q9UBI13EBI-1550112,EBI-714979
COMMD4Q9H0A82EBI-1550112,EBI-1550064
COMMD6Q7Z4G12EBI-1550112,EBI-1550081
CUL2Q136173EBI-1550112,EBI-456179
NFKBIAP259633EBI-1550112,EBI-307386
RELQ048643EBI-1550112,EBI-307352
RELAQ042067EBI-1550112,EBI-73886
RELBQ012012EBI-1550112,EBI-357837
SCNN1DP511723EBI-1550112,EBI-2547114
SOCS1O155243EBI-1550112,EBI-968198

Protein-protein interaction databases

BioGridi127317. 52 interactions.
IntActiQ8N668. 25 interactions.
MINTiMINT-4140741.
STRINGi9606.ENSP00000308236.

Structurei

Secondary structure

1
190
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Beta strandi3 – 53Combined sources
Helixi9 – 135Combined sources
Helixi15 – 184Combined sources
Beta strandi23 – 253Combined sources
Helixi32 – 398Combined sources
Beta strandi41 – 433Combined sources
Helixi48 – 525Combined sources
Turni53 – 553Combined sources
Helixi59 – 624Combined sources
Turni63 – 653Combined sources
Turni69 – 713Combined sources
Turni73 – 753Combined sources
Helixi76 – 794Combined sources
Beta strandi82 – 843Combined sources
Helixi88 – 947Combined sources
Turni95 – 1017Combined sources
Beta strandi102 – 1065Combined sources

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
2H2MNMR-A1-108[»]
ProteinModelPortaliQ8N668.
SMRiQ8N668. Positions 1-108.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ8N668.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini118 – 18669COMMPROSITE-ProRule annotationAdd
BLAST

Sequence similaritiesi

Contains 1 COMM domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiNOG46398.
GeneTreeiENSGT00390000012029.
HOGENOMiHOG000236295.
HOVERGENiHBG051067.
InParanoidiQ8N668.
OMAiLLAQSRW.
PhylomeDBiQ8N668.
TreeFamiTF332823.

Family and domain databases

InterProiIPR017920. COMM.
IPR009886. HCaRG.
[Graphical view]
PfamiPF07258. HCaRG. 1 hit.
[Graphical view]
PROSITEiPS51269. COMM. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q8N668-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAAGELEGGK PLSGLLNALA QDTFHGYPGI TEELLRSQLY PEVPPEEFRP
60 70 80 90 100
FLAKMRGILK SIASADMDFN QLEAFLTAQT KKQGGITSDQ AAVISKFWKS
110 120 130 140 150
HKTKIRESLM NQSRWNSGLR GLSWRVDGKS QSRHSAQIHT PVAIIELELG
160 170 180 190
KYGQESEFLC LEFDEVKVNQ ILKTLSEVEE SISTLISQPN
Length:190
Mass (Da):21,178
Last modified:October 1, 2002 - v1
Checksum:i9C810AECA67011DC
GO
Isoform 2 (identifier: Q8N668-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     155-190: ESEFLCLEFDEVKVNQILKTLSEVEESISTLISQPN → VHCNQ

Note: No experimental confirmation available.

Show »
Length:159
Mass (Da):17,665
Checksum:i3914BE73CBDD80F8
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei155 – 19036ESEFL…ISQPN → VHCNQ in isoform 2. 1 PublicationVSP_055532Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB178811 mRNA. Translation: BAD18972.1.
AK294203 mRNA. Translation: BAG57515.1.
AC018462 Genomic DNA. No translation available.
AC107081 Genomic DNA. No translation available.
AC116652 Genomic DNA. No translation available.
BC009266 mRNA. Translation: AAH09266.2.
BC022046 mRNA. Translation: AAH22046.1.
CCDSiCCDS1869.1. [Q8N668-1]
RefSeqiNP_689729.1. NM_152516.2. [Q8N668-1]
UniGeneiHs.468702.

Genome annotation databases

EnsembliENST00000311832; ENSP00000308236; ENSG00000173163. [Q8N668-1]
GeneIDi150684.
KEGGihsa:150684.
UCSCiuc002sbp.3. human. [Q8N668-1]

Polymorphism databases

DMDMi51316026.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB178811 mRNA. Translation: BAD18972.1 .
AK294203 mRNA. Translation: BAG57515.1 .
AC018462 Genomic DNA. No translation available.
AC107081 Genomic DNA. No translation available.
AC116652 Genomic DNA. No translation available.
BC009266 mRNA. Translation: AAH09266.2 .
BC022046 mRNA. Translation: AAH22046.1 .
CCDSi CCDS1869.1. [Q8N668-1 ]
RefSeqi NP_689729.1. NM_152516.2. [Q8N668-1 ]
UniGenei Hs.468702.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
2H2M NMR - A 1-108 [» ]
ProteinModelPortali Q8N668.
SMRi Q8N668. Positions 1-108.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 127317. 52 interactions.
IntActi Q8N668. 25 interactions.
MINTi MINT-4140741.
STRINGi 9606.ENSP00000308236.

PTM databases

PhosphoSitei Q8N668.

Polymorphism databases

DMDMi 51316026.

Proteomic databases

MaxQBi Q8N668.
PaxDbi Q8N668.
PRIDEi Q8N668.

Protocols and materials databases

DNASUi 150684.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000311832 ; ENSP00000308236 ; ENSG00000173163 . [Q8N668-1 ]
GeneIDi 150684.
KEGGi hsa:150684.
UCSCi uc002sbp.3. human. [Q8N668-1 ]

Organism-specific databases

CTDi 150684.
GeneCardsi GC02P062115.
HGNCi HGNC:23024. COMMD1.
HPAi HPA034633.
MIMi 607238. gene.
neXtProti NX_Q8N668.
PharmGKBi PA134891368.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG46398.
GeneTreei ENSGT00390000012029.
HOGENOMi HOG000236295.
HOVERGENi HBG051067.
InParanoidi Q8N668.
OMAi LLAQSRW.
PhylomeDBi Q8N668.
TreeFami TF332823.

Miscellaneous databases

ChiTaRSi COMMD1. human.
EvolutionaryTracei Q8N668.
GeneWikii COMMD1.
GenomeRNAii 150684.
NextBioi 35471554.
PROi Q8N668.
SOURCEi Search...

Gene expression databases

Bgeei Q8N668.
CleanExi HS_COMMD1.
ExpressionAtlasi Q8N668. baseline and differential.
Genevestigatori Q8N668.

Family and domain databases

InterProi IPR017920. COMM.
IPR009886. HCaRG.
[Graphical view ]
Pfami PF07258. HCaRG. 1 hit.
[Graphical view ]
PROSITEi PS51269. COMM. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
  2. "Analysis of the human homologue of the canine copper toxicosis gene MURR1 in Wilson disease patients."
    Stuehler B., Reichert J., Stremmel W., Schaefer M.
    J. Mol. Med. 82:629-634(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
  3. "Comparative analyses of gene imprinting and CpG island methylation around mouse Murr1 and human syntenic region identify the 5'-portion of U2af1-rs1 CpG island as an imprinting control region."
    Zhang Z., Yatsuki H., Wang Y., Joh K., Nabetani A., Hatada I., Soejima H., Iwasaka T., Mukai T.
    Submitted (MAY-2004) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Tissue: Kidney.
  4. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Amygdala.
  5. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
    Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
    , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
    Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Ovary and Skin.
  7. "Identification of a new copper metabolism gene by positional cloning in a purebred dog population."
    van De Sluis B.A.J., Rothuizen J., Pearson P.L., van Oost B.A., Wijmenga C.
    Hum. Mol. Genet. 11:165-173(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: TISSUE SPECIFICITY.
  8. "The copper toxicosis gene product Murr1 directly interacts with the Wilson disease protein."
    Tao T.Y., Liu F., Klomp L., Wijmenga C., Gitlin J.D.
    J. Biol. Chem. 278:41593-41596(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH ATP7B.
  9. Cited for: FUNCTION, UBIQUITINATION, INTERACTION WITH XIAP.
  10. Cited for: FUNCTION, INTERACTION WITH RELA; COMMD2; COMMD3; COMMD4; COMMD5; COMMD6; COMMD7; COMMD8 AND COMMD10, IDENTIFICATION IN A COMPLEX WITH NF-KAPPA-B, SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
  11. "Characterization of COMMD protein-protein interactions in NF-kappaB signalling."
    de Bie P., van de Sluis B., Burstein E., Duran K.J., Berger R., Duckett C.S., Wijmenga C., Klomp L.W.
    Biochem. J. 398:63-71(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, INTERACTION WITH COMMD6 AND NFKBIB, SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
  12. "Characterization and copper binding properties of human COMMD1 (MURR1)."
    Narindrasorasak S., Kulkarni P., Deschamps P., She Y.M., Sarkar B.
    Biochemistry 46:3116-3128(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, SUBUNIT, IDENTIFICATION BY MASS SPECTROMETRY, MUTAGENESIS OF MET-110 AND HIS-134, COPPER-BINDING.
  13. "COMMD1 promotes the ubiquitination of NF-kappaB subunits through a cullin-containing ubiquitin ligase."
    Maine G.N., Mao X., Komarck C.M., Burstein E.
    EMBO J. 26:436-447(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, SUBUNIT, INTERACTION WITH SOCS1 AND CUL2, IDENTIFICATION IN AN E3 UBIQUITIN LIGASE COMPLEX COMPOSED OF TCEB1/ELONGIN C; CUL2; SOCS1 AND RBX1.
  14. "Tumor suppressor ARF promotes non-classic proteasome-independent polyubiquitination of COMMD1."
    Huang Y., Wu M., Li H.Y.
    J. Biol. Chem. 283:11453-11460(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: UBIQUITINATION, SUBCELLULAR LOCATION, INTERACTION WITH CDKN2A.
  15. "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach."
    Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S.
    Anal. Chem. 81:4493-4501(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT ALA-2, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS], CLEAVAGE OF INITIATOR METHIONINE [LARGE SCALE ANALYSIS].
  16. "Nucleolar targeting of RelA(p65) is regulated by COMMD1-dependent ubiquitination."
    Thoms H.C., Loveridge C.J., Simpson J., Clipson A., Reinhardt K., Dunlop M.G., Stark L.A.
    Cancer Res. 70:139-149(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION.
  17. "Cu,Zn superoxide dismutase maturation and activity are regulated by COMMD1."
    Vonk W.I., Wijmenga C., Berger R., van de Sluis B., Klomp L.W.
    J. Biol. Chem. 285:28991-29000(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, INTERACTION WITH CCS.
  18. "Clusterin facilitates COMMD1 and I-kappaB degradation to enhance NF-kappaB activity in prostate cancer cells."
    Zoubeidi A., Ettinger S., Beraldi E., Hadaschik B., Zardan A., Klomp L.W., Nelson C.C., Rennie P.S., Gleave M.E.
    Mol. Cancer Res. 8:119-130(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: SUBCELLULAR LOCATION, UBIQUITINATION, PROTEASOMAL DEGRADATION, INTERACTION WITH CLU.
  19. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  20. "Solution structure of the COMMD1 N-terminal domain."
    Sommerhalter M., Zhang Y., Rosenzweig A.C.
    J. Mol. Biol. 365:715-721(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: STRUCTURE BY NMR OF 1-108.

Entry informationi

Entry nameiCOMD1_HUMAN
AccessioniPrimary (citable) accession number: Q8N668
Secondary accession number(s): B4DFQ4, Q96GS0
Entry historyi
Integrated into UniProtKB/Swiss-Prot: August 16, 2004
Last sequence update: October 1, 2002
Last modified: November 26, 2014
This is version 97 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3