Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Meiosis-specific with OB domain-containing protein

Gene

MEIOB

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at transcript leveli

Functioni

Single-stranded DNA-binding protein required for homologous recombination in meiosis I. Required for double strand breaks (DSBs) repair and crossover formation and promotion of faithful and complete synapsis. Not required for the initial loading of recombinases but required to maintain a proper number of RAD51 and DMC1 foci after the zygotene stage. May act by ensuring the stabilization of recombinases, which is required for successful homology search and meiotic recombination. Displays Single-stranded DNA 3'-5' exonuclease activity in vitro (By similarity).By similarity

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
DNA bindingi167 – 272OBAdd BLAST106

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionDNA-binding, Exonuclease, Hydrolase, Nuclease
Biological processMeiosis

Names & Taxonomyi

Protein namesi
Recommended name:
Meiosis-specific with OB domain-containing protein (EC:3.1.-.-)
Gene namesi
Name:MEIOB
Synonyms:C16orf73
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 16

Organism-specific databases

EuPathDBiHostDB:ENSG00000162039.14
HGNCiHGNC:28569 MEIOB
MIMi617670 gene
neXtProtiNX_Q8N635

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Chromosome, Cytoplasm, Nucleus

Pathology & Biotechi

Involvement in diseasei

Spermatogenic failure 22 (SPGF22)1 Publication
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionAn infertility disorder caused by spermatogenesis defects that result in non-obstructive azoospermia.
See also OMIM:617706
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_08003464N → I in SPGF22. 1 Publication1

Organism-specific databases

MalaCardsiMEIOB
MIMi617706 phenotype
OpenTargetsiENSG00000162039
PharmGKBiPA145149601

Polymorphism and mutation databases

BioMutaiMEIOB
DMDMi229462984

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003371341 – 442Meiosis-specific with OB domain-containing proteinAdd BLAST442

Proteomic databases

PeptideAtlasiQ8N635
PRIDEiQ8N635

PTM databases

iPTMnetiQ8N635
PhosphoSitePlusiQ8N635

Expressioni

Tissue specificityi

In fetal gonads, specifically expressed in the ovary starting at the 14th weeks post fertilization (PubMed:24068956). In the adult, restricted to testis (PubMed:28206990).2 Publications

Gene expression databases

BgeeiENSG00000162039
CleanExiHS_C16orf73
ExpressionAtlasiQ8N635 baseline and differential
GenevisibleiQ8N635 HS

Organism-specific databases

HPAiHPA042547

Interactioni

Subunit structurei

Component of a multiprotein complex with RPA2 and SPATA22.By similarity

Protein-protein interaction databases

BioGridi129038, 3 interactors

Structurei

3D structure databases

ProteinModelPortaliQ8N635
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the MEIOB family.Curated

Phylogenomic databases

GeneTreeiENSGT00390000001723
HOGENOMiHOG000111901
HOVERGENiHBG107750
InParanoidiQ8N635
KOiK22420
OMAiFTTSDRR
OrthoDBiEOG091G0ICR
PhylomeDBiQ8N635
TreeFamiTF323670

Family and domain databases

InterProiView protein in InterPro
IPR012340 NA-bd_OB-fold
SUPFAMiSSF50249 SSF50249, 2 hits

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8N635-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MANSFAARIF TTLSDLQTNM ANLKVIGIVI GKTDVKGFPD RKNIGSERYT
60 70 80 90 100
FSFTIRDSPA HFVNAASWGN EDYIKSLSDS FRVGDCVIIE NPLIQRKEIE
110 120 130 140 150
REEKFSPATP SNCKLLLSEN HSTVKVCSSY EVDTKLLSLI HLPVKESHDY
160 170 180 190 200
YSLGDIVANG HSLNGRIINV LAAVKSVGEP KYFTTSDRRK GQRCEVRLYD
210 220 230 240 250
ETESSFAMTC WDNESILLAQ SWMPRETVIF ASDVRINFDK FRNCMTATVI
260 270 280 290 300
SKTIITTNPD IPEANILLNF IRENKETNVL DDEIDSYFKE SINLSTIVDV
310 320 330 340 350
YTVEQLKGKA LKNEGKADPS YGILYAYIST LNIDDETTKV VRNRCSSCGY
360 370 380 390 400
IVNEASNMCT TCNKNSLDFK SVFLSFHVLI DLTDHTGTLH SCSLTGSVAE
410 420 430 440
ETLGCTFVLS HRARSGLKIS VLSCKLADPT EASRNLSGQK HV
Length:442
Mass (Da):49,313
Last modified:May 5, 2009 - v3
Checksum:i3418C8EB3672EE8F
GO
Isoform 2 (identifier: Q8N635-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     406-406: T → TVHEFLAMTDEQKTALKWQFLLERSKIYLK

Note: No experimental confirmation available.
Show »
Length:471
Mass (Da):52,862
Checksum:i64FBA7364EF3F6AD
GO

Sequence cautioni

The sequence AAH29829 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence AAK61296 differs from that shown. Reason: Erroneous gene model prediction.Curated

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_06161918T → P. Corresponds to variant dbSNP:rs1742446Ensembl.1
Natural variantiVAR_08003464N → I in SPGF22. 1 Publication1
Natural variantiVAR_05962475K → T. Corresponds to variant dbSNP:rs1657125Ensembl.1
Natural variantiVAR_043620261I → T. Corresponds to variant dbSNP:rs9806945Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_047664406T → TVHEFLAMTDEQKTALKWQF LLERSKIYLK in isoform 2. Curated1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AE006639 Genomic DNA Translation: AAK61296.1 Sequence problems.
AL031722, AL499628 Genomic DNA Translation: CAM26474.1
AL499628, AL031722 Genomic DNA Translation: CAM28376.1
AL132823 Genomic DNA No translation available.
BC029829 mRNA Translation: AAH29829.1 Different initiation.
CCDSiCCDS10449.2 [Q8N635-1]
CCDS53983.1 [Q8N635-2]
RefSeqiNP_001157032.1, NM_001163560.2 [Q8N635-2]
NP_689977.2, NM_152764.2 [Q8N635-1]
UniGeneiHs.729604

Genome annotation databases

EnsembliENST00000325962; ENSP00000314484; ENSG00000162039 [Q8N635-2]
ENST00000397344; ENSP00000380504; ENSG00000162039 [Q8N635-1]
ENST00000412554; ENSP00000390778; ENSG00000162039 [Q8N635-2]
GeneIDi254528
KEGGihsa:254528
UCSCiuc002cne.3 human [Q8N635-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiMEIOB_HUMAN
AccessioniPrimary (citable) accession number: Q8N635
Secondary accession number(s): B1AK39, C9J0S1, Q96RY0
Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 20, 2008
Last sequence update: May 5, 2009
Last modified: May 23, 2018
This is version 109 of the entry and version 3 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 16
    Human chromosome 16: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Cookie policy

We would like to use anonymized google analytics cookies to gather statistics on how uniprot.org is used in aggregate. Learn more

UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health