Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Meiosis-specific with OB domain-containing protein

Gene

MEIOB

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at transcript leveli

Functioni

Single-stranded DNA-binding protein required for homologous recombination in meiosis I. Required for double strand breaks (DSBs) repair and crossover formation and promotion of faithful and complete synapsis. Not required for the initial loading of recombinases but required to maintain a proper number of RAD51 and DMC1 foci after the zygotene stage. May act by ensuring the stabilization of recombinases, which is required for successful homology search and meiotic recombination. Displays Single-stranded DNA 3'-5' exonuclease activity in vitro (By similarity).By similarity

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
DNA bindingi167 – 272106OBAdd
BLAST

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Exonuclease, Hydrolase, Nuclease

Keywords - Biological processi

Meiosis

Keywords - Ligandi

DNA-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Meiosis-specific with OB domain-containing protein (EC:3.1.-.-)
Gene namesi
Name:MEIOB
Synonyms:C16orf73
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 16

Organism-specific databases

HGNCiHGNC:28569. MEIOB.

Subcellular locationi

  • Cytoplasm By similarity
  • Nucleus By similarity
  • Chromosome By similarity

  • Note: Co-localizes with the RPA complex on meiotic chromosome axes. Accumulates on resected DNA. Localization is dependent on SPATA22 (By similarity).By similarity

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Chromosome, Cytoplasm, Nucleus

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA145149601.

Polymorphism and mutation databases

BioMutaiMEIOB.
DMDMi229462984.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 442442Meiosis-specific with OB domain-containing proteinPRO_0000337134Add
BLAST

Proteomic databases

PRIDEiQ8N635.

PTM databases

PhosphoSiteiQ8N635.

Expressioni

Tissue specificityi

In fetal gonads, specifically expressed in the ovary starting at the 14th weeks post fertilization.1 Publication

Gene expression databases

BgeeiQ8N635.
CleanExiHS_C16orf73.
ExpressionAtlasiQ8N635. baseline and differential.
GenevisibleiQ8N635. HS.

Organism-specific databases

HPAiHPA042161.
HPA042547.

Interactioni

Subunit structurei

Component of a multiprotein complex with RPA2 and SPATA22.By similarity

Protein-protein interaction databases

BioGridi129038. 2 interactions.

Structurei

3D structure databases

ProteinModelPortaliQ8N635.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the MEIOB family.Curated
Contains 1 OB DNA-binding domain.Curated

Phylogenomic databases

GeneTreeiENSGT00390000001723.
HOGENOMiHOG000111901.
HOVERGENiHBG107750.
InParanoidiQ8N635.
OMAiNFDKFRN.
PhylomeDBiQ8N635.
TreeFamiTF323670.

Family and domain databases

Gene3Di2.40.50.140. 1 hit.
InterProiIPR012340. NA-bd_OB-fold.
[Graphical view]
SUPFAMiSSF50249. SSF50249. 2 hits.

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8N635-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MANSFAARIF TTLSDLQTNM ANLKVIGIVI GKTDVKGFPD RKNIGSERYT
60 70 80 90 100
FSFTIRDSPA HFVNAASWGN EDYIKSLSDS FRVGDCVIIE NPLIQRKEIE
110 120 130 140 150
REEKFSPATP SNCKLLLSEN HSTVKVCSSY EVDTKLLSLI HLPVKESHDY
160 170 180 190 200
YSLGDIVANG HSLNGRIINV LAAVKSVGEP KYFTTSDRRK GQRCEVRLYD
210 220 230 240 250
ETESSFAMTC WDNESILLAQ SWMPRETVIF ASDVRINFDK FRNCMTATVI
260 270 280 290 300
SKTIITTNPD IPEANILLNF IRENKETNVL DDEIDSYFKE SINLSTIVDV
310 320 330 340 350
YTVEQLKGKA LKNEGKADPS YGILYAYIST LNIDDETTKV VRNRCSSCGY
360 370 380 390 400
IVNEASNMCT TCNKNSLDFK SVFLSFHVLI DLTDHTGTLH SCSLTGSVAE
410 420 430 440
ETLGCTFVLS HRARSGLKIS VLSCKLADPT EASRNLSGQK HV
Length:442
Mass (Da):49,313
Last modified:May 5, 2009 - v3
Checksum:i3418C8EB3672EE8F
GO
Isoform 2 (identifier: Q8N635-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     406-406: T → TVHEFLAMTDEQKTALKWQFLLERSKIYLK

Note: No experimental confirmation available.
Show »
Length:471
Mass (Da):52,862
Checksum:i64FBA7364EF3F6AD
GO

Sequence cautioni

The sequence AAH29829.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence AAK61296.1 differs from that shown. Reason: Erroneous gene model prediction. Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti18 – 181T → P.
Corresponds to variant rs1742446 [ dbSNP | Ensembl ].
VAR_061619
Natural varianti75 – 751K → T.
Corresponds to variant rs1657125 [ dbSNP | Ensembl ].
VAR_059624
Natural varianti261 – 2611I → T.
Corresponds to variant rs9806945 [ dbSNP | Ensembl ].
VAR_043620

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei406 – 4061T → TVHEFLAMTDEQKTALKWQF LLERSKIYLK in isoform 2. CuratedVSP_047664

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AE006639 Genomic DNA. Translation: AAK61296.1. Sequence problems.
AL031722, AL499628 Genomic DNA. Translation: CAM26474.1.
AL499628, AL031722 Genomic DNA. Translation: CAM28376.1.
AL132823 Genomic DNA. No translation available.
BC029829 mRNA. Translation: AAH29829.1. Different initiation.
CCDSiCCDS10449.2. [Q8N635-1]
CCDS53983.1. [Q8N635-2]
RefSeqiNP_001157032.1. NM_001163560.2. [Q8N635-2]
NP_689977.2. NM_152764.2. [Q8N635-1]
UniGeneiHs.729604.

Genome annotation databases

EnsembliENST00000325962; ENSP00000314484; ENSG00000162039. [Q8N635-2]
ENST00000397344; ENSP00000380504; ENSG00000162039. [Q8N635-1]
ENST00000412554; ENSP00000390778; ENSG00000162039. [Q8N635-2]
GeneIDi254528.
KEGGihsa:254528.
UCSCiuc002cne.3. human. [Q8N635-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AE006639 Genomic DNA. Translation: AAK61296.1. Sequence problems.
AL031722, AL499628 Genomic DNA. Translation: CAM26474.1.
AL499628, AL031722 Genomic DNA. Translation: CAM28376.1.
AL132823 Genomic DNA. No translation available.
BC029829 mRNA. Translation: AAH29829.1. Different initiation.
CCDSiCCDS10449.2. [Q8N635-1]
CCDS53983.1. [Q8N635-2]
RefSeqiNP_001157032.1. NM_001163560.2. [Q8N635-2]
NP_689977.2. NM_152764.2. [Q8N635-1]
UniGeneiHs.729604.

3D structure databases

ProteinModelPortaliQ8N635.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi129038. 2 interactions.

PTM databases

PhosphoSiteiQ8N635.

Polymorphism and mutation databases

BioMutaiMEIOB.
DMDMi229462984.

Proteomic databases

PRIDEiQ8N635.

Protocols and materials databases

DNASUi254528.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000325962; ENSP00000314484; ENSG00000162039. [Q8N635-2]
ENST00000397344; ENSP00000380504; ENSG00000162039. [Q8N635-1]
ENST00000412554; ENSP00000390778; ENSG00000162039. [Q8N635-2]
GeneIDi254528.
KEGGihsa:254528.
UCSCiuc002cne.3. human. [Q8N635-1]

Organism-specific databases

CTDi254528.
GeneCardsiMEIOB.
HGNCiHGNC:28569. MEIOB.
HPAiHPA042161.
HPA042547.
neXtProtiNX_Q8N635.
PharmGKBiPA145149601.
GenAtlasiSearch...

Phylogenomic databases

GeneTreeiENSGT00390000001723.
HOGENOMiHOG000111901.
HOVERGENiHBG107750.
InParanoidiQ8N635.
OMAiNFDKFRN.
PhylomeDBiQ8N635.
TreeFamiTF323670.

Miscellaneous databases

GenomeRNAii254528.
NextBioi92360.
PROiQ8N635.

Gene expression databases

BgeeiQ8N635.
CleanExiHS_C16orf73.
ExpressionAtlasiQ8N635. baseline and differential.
GenevisibleiQ8N635. HS.

Family and domain databases

Gene3Di2.40.50.140. 1 hit.
InterProiIPR012340. NA-bd_OB-fold.
[Graphical view]
SUPFAMiSSF50249. SSF50249. 2 hits.
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Sequence, structure and pathology of the fully annotated terminal 2 Mb of the short arm of human chromosome 16."
    Daniels R.J., Peden J.F., Lloyd C., Horsley S.W., Clark K., Tufarelli C., Kearney L., Buckle V.J., Doggett N.A., Flint J., Higgs D.R.
    Hum. Mol. Genet. 10:339-352(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  2. "The sequence and analysis of duplication-rich human chromosome 16."
    Martin J., Han C., Gordon L.A., Terry A., Prabhakar S., She X., Xie G., Hellsten U., Chan Y.M., Altherr M., Couronne O., Aerts A., Bajorek E., Black S., Blumer H., Branscomb E., Brown N.C., Bruno W.J.
    , Buckingham J.M., Callen D.F., Campbell C.S., Campbell M.L., Campbell E.W., Caoile C., Challacombe J.F., Chasteen L.A., Chertkov O., Chi H.C., Christensen M., Clark L.M., Cohn J.D., Denys M., Detter J.C., Dickson M., Dimitrijevic-Bussod M., Escobar J., Fawcett J.J., Flowers D., Fotopulos D., Glavina T., Gomez M., Gonzales E., Goodstein D., Goodwin L.A., Grady D.L., Grigoriev I., Groza M., Hammon N., Hawkins T., Haydu L., Hildebrand C.E., Huang W., Israni S., Jett J., Jewett P.B., Kadner K., Kimball H., Kobayashi A., Krawczyk M.-C., Leyba T., Longmire J.L., Lopez F., Lou Y., Lowry S., Ludeman T., Manohar C.F., Mark G.A., McMurray K.L., Meincke L.J., Morgan J., Moyzis R.K., Mundt M.O., Munk A.C., Nandkeshwar R.D., Pitluck S., Pollard M., Predki P., Parson-Quintana B., Ramirez L., Rash S., Retterer J., Ricke D.O., Robinson D.L., Rodriguez A., Salamov A., Saunders E.H., Scott D., Shough T., Stallings R.L., Stalvey M., Sutherland R.D., Tapia R., Tesmer J.G., Thayer N., Thompson L.S., Tice H., Torney D.C., Tran-Gyamfi M., Tsai M., Ulanovsky L.E., Ustaszewska A., Vo N., White P.S., Williams A.L., Wills P.L., Wu J.-R., Wu K., Yang J., DeJong P., Bruce D., Doggett N.A., Deaven L., Schmutz J., Grimwood J., Richardson P., Rokhsar D.S., Eichler E.E., Gilna P., Lucas S.M., Myers R.M., Rubin E.M., Pennacchio L.A.
    Nature 432:988-994(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 95-442 (ISOFORM 1).
    Tissue: Brain.
  4. Cited for: TISSUE SPECIFICITY.

Entry informationi

Entry nameiMEIOB_HUMAN
AccessioniPrimary (citable) accession number: Q8N635
Secondary accession number(s): B1AK39, C9J0S1, Q96RY0
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 20, 2008
Last sequence update: May 5, 2009
Last modified: March 16, 2016
This is version 96 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 16
    Human chromosome 16: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.