Q8N5Y2 (MS3L1_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 108.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Male-specific lethal 3 homolog Alternative name(s): Male-specific lethal-3 homolog 1 Male-specific lethal-3 protein-like 1 Short name=MSL3-like 1 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 521 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | May be involved in chromatin remodeling and transcriptional regulation. May have a role in X inactivation. Component of the MSL complex which is responsible for the majority of histone H4 acetylation at 'Lys-16' which is implicated in the formation of higher-order chromatin structure. Specifically recognizes histone H4 monomethylated at 'Lys-20' (H4K20Me1) in a DNA-dependent manner and is proposed to be involved in chromosomal targeting of the MSL complex. Ref.7 Ref.11 Ref.14 Ref.15 |
| Subunit structure | Component the MSL histone acetyltransferase complex at least composed of the MOF/KAT8, MSL1/hampin, MSL2 and MSL3. Ref.11 |
| Subcellular location | Nucleus Probable. |
| Tissue specificity | Expressed in many tissues including liver, pancreas, heart, lung, kidney, skeletal muscle, brain, and placenta, with highest expression in skeletal muscle and heart. |
| Miscellaneous | MSL3L1 gene undergoes X inactivation. |
| Sequence similarities | Contains 1 chromo domain. Contains 1 MRG domain. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Transcription Transcription regulation |
| Cellular component | Nucleus |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Ligand | DNA-binding |
| Molecular function | Chromatin regulator |
| PTM | Phosphoprotein |
| Technical term | 3D-structure Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | histone H4-K16 acetylation Inferred from direct assay Ref.11. Source: UniProtKB multicellular organismal developmentTraceable author statement Ref.1. Source: ProtInc transcription from RNA polymerase II promoterTraceable author statement Ref.1. Source: ProtInc |
| Cellular_component | MSL complex Inferred from direct assay Ref.11. Source: UniProtKB |
| Molecular_function | DNA binding Inferred from direct assay Ref.14. Source: UniProtKB methylated histone residue bindingInferred from direct assay Ref.14. Source: UniProtKB sequence-specific DNA binding transcription factor activityTraceable author statement Ref.1. Source: ProtInc |
| Complete GO annotation... | |
Alternative products
| This entry describes 5 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q8N5Y2-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q8N5Y2-2) The sequence of this isoform differs from the canonical sequence as follows: 1-59: Missing. 60-61: NR → MP | ||||||
| Isoform 3 (identifier: Q8N5Y2-3) The sequence of this isoform differs from the canonical sequence as follows: 1-34: MSASEGMKFKFHSGEKVLCFEPDPTKARVLYDAK → MSPSVRPGAGWAPVGRPGRPIQ | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 4 (identifier: Q8N5Y2-4) The sequence of this isoform differs from the canonical sequence as follows: 1-166: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 5 (identifier: Q8N5Y2-5) The sequence of this isoform differs from the canonical sequence as follows: 391-416: KTPVHSRSSSPIPLTPSKEGSAVFAG → SRFILGCPRPGRASVYFVFSQCQAWC 417-521: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||||||||||||||||||||||||
Molecule processing | ||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 521 | 521 | Male-specific lethal 3 homolog | PRO_0000080247 | ||||||||||||||||||||||||||||||||||||||
Regions | ||||||||||||||||||||||||||||||||||||||||||
| Domain | 32 – 90 | 59 | Chromo | |||||||||||||||||||||||||||||||||||||||
| Domain | 168 – 517 | 350 | MRG | |||||||||||||||||||||||||||||||||||||||
Amino acid modifications | ||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 311 | 1 | Phosphoserine Ref.10 | |||||||||||||||||||||||||||||||||||||||
| Modified residue | 367 | 1 | Phosphoserine Ref.9 Ref.12 | |||||||||||||||||||||||||||||||||||||||
| Modified residue | 400 | 1 | Phosphoserine Ref.13 | |||||||||||||||||||||||||||||||||||||||
| Modified residue | 405 | 1 | Phosphothreonine Ref.10 | |||||||||||||||||||||||||||||||||||||||
| Modified residue | 407 | 1 | Phosphoserine Ref.9 Ref.10 | |||||||||||||||||||||||||||||||||||||||
| Modified residue | 411 | 1 | Phosphoserine Ref.9 | |||||||||||||||||||||||||||||||||||||||
Natural variations | ||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 166 | 166 | Missing in isoform 4. | VSP_045652 | ||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 59 | 59 | Missing in isoform 2. | VSP_007636 | ||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 34 | 34 | MSASE…LYDAK → MSPSVRPGAGWAPVGRPGRP IQ in isoform 3. | VSP_043342 | ||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 60 – 61 | 2 | NR → MP in isoform 2. | VSP_007637 | ||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 391 – 416 | 26 | KTPVH…AVFAG → SRFILGCPRPGRASVYFVFS QCQAWC in isoform 5. | VSP_045653 | ||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 417 – 521 | 105 | Missing in isoform 5. | VSP_045654 | ||||||||||||||||||||||||||||||||||||||
| Natural variant | 2 | 1 | S → T. Ref.2 Corresponds to variant rs150938844 [ dbSNP | Ensembl ]. | VAR_069061 | ||||||||||||||||||||||||||||||||||||||
| Natural variant | 199 | 1 | K → Q. Corresponds to variant rs1051595 [ dbSNP | Ensembl ]. | VAR_048732 | ||||||||||||||||||||||||||||||||||||||
| Natural variant | 251 | 1 | V → I. Corresponds to variant rs1051600 [ dbSNP | Ensembl ]. | VAR_048733 | ||||||||||||||||||||||||||||||||||||||
Experimental info | ||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 31 | 1 | Y → A: Diminishes interaction with histone H4 monomethylated at 'Lys-20'(H4K20Me1). Ref.15 | |||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 55 | 1 | H → A: Diminishes DNA-bindig; when associated with A-65. Ref.14 | |||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 56 | 1 | F → A: Abolishes interaction with histone H4 monomethylated at 'Lys-20'(H4K20Me1). | |||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 59 | 1 | W → G: Diminishes DNA-binding. Ref.14 | |||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 65 | 1 | R → A: Diminishes DNA-bindig; when associated with A-55. Ref.14 | |||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 37 | 1 | D → V in AAD38499. Ref.1 | |||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 346 | 1 | Q → R in AK025642. Ref.2 | |||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 391 | 1 | K → E in AK025642. Ref.2 | |||||||||||||||||||||||||||||||||||||||
Secondary structure | ||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 16 – 20 | 5 | ||||||||||||||||||||||||||||||||||||||||
| Beta strand | 30 – 42 | 13 | ||||||||||||||||||||||||||||||||||||||||
| Beta strand | 48 – 56 | 9 | ||||||||||||||||||||||||||||||||||||||||
| Helix | 61 – 63 | 3 | ||||||||||||||||||||||||||||||||||||||||
| Beta strand | 65 – 68 | 4 | ||||||||||||||||||||||||||||||||||||||||
| Helix | 69 – 71 | 3 | ||||||||||||||||||||||||||||||||||||||||
| Beta strand | 72 – 74 | 3 | ||||||||||||||||||||||||||||||||||||||||
| Helix | 77 – 91 | 15 | ||||||||||||||||||||||||||||||||||||||||
| Helix | 178 – 192 | 15 | ||||||||||||||||||||||||||||||||||||||||
| Helix | 206 – 222 | 17 | ||||||||||||||||||||||||||||||||||||||||
| Helix | 251 – 272 | 22 | ||||||||||||||||||||||||||||||||||||||||
| Helix | 276 – 278 | 3 | ||||||||||||||||||||||||||||||||||||||||
| Helix | 279 – 287 | 9 | ||||||||||||||||||||||||||||||||||||||||
| Helix | 447 – 449 | 3 | ||||||||||||||||||||||||||||||||||||||||
| Helix | 453 – 469 | 17 | ||||||||||||||||||||||||||||||||||||||||
| Helix | 474 – 493 | 20 | ||||||||||||||||||||||||||||||||||||||||
| Helix | 495 – 498 | 4 | ||||||||||||||||||||||||||||||||||||||||
| Helix | 501 – 503 | 3 | ||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Characterization of a novel chromo domain gene in Xp22.3 with homology to Drosophila msl-3." Prakash S.K., Van den Veyver I.B., Franco B., Volta M., Ballabio A., Zoghbi H.Y. Genomics 59:77-84(1999) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2). |
| [2] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3; 4 AND 5), VARIANT THR-2. Tissue: Brain and Hepatoma. |
| [3] | "The DNA sequence of the human X chromosome." Ross M.T., Grafham D.V., Coffey A.J., Scherer S., McLay K., Muzny D., Platzer M., Howell G.R., Burrows C., Bird C.P., Frankish A., Lovell F.L., Howe K.L., Ashurst J.L., Fulton R.S., Sudbrak R., Wen G., Jones M.C. Bentley D.R.Nature 434:325-337(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | Mural R.J., Istrail S., Sutton G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Brain. |
| [6] | "The full-ORF clone resource of the German cDNA consortium." Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I. BMC Genomics 8:399-399(2007) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 283-521. Tissue: Uterus. |
| [7] | "A human protein complex homologous to the Drosophila MSL complex is responsible for the majority of histone H4 acetylation at lysine 16." Smith E.R., Cayrou C., Huang R., Lane W.S., Cote J., Lucchesi J.C. Mol. Cell. Biol. 25:9175-9188(2005) [PubMed] [Europe PMC] [Abstract] Cited for: MASS SPECTROMETRY, IDENTIFICATION OF MSL COMPLEX COMPONENTS, FUNCTION OF THE MSL COMPLEX. |
| [8] | Erratum Smith E.R., Cayrou C., Huang R., Lane W.S., Cote J., Lucchesi J.C. Mol. Cell. Biol. 26:387-387(2006) |
| [9] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-367; SER-407 AND SER-411, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [10] | "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions." Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K. Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-311; THR-405 AND SER-407, MASS SPECTROMETRY. Tissue: Leukemic T-cell. |
| [11] | "Subunit composition and substrate specificity of a MOF-containing histone acetyltransferase distinct from the male-specific lethal (MSL) complex." Cai Y., Jin J., Swanson S.K., Cole M.D., Choi S.H., Florens L., Washburn M.P., Conaway J.W., Conaway R.C. J. Biol. Chem. 285:4268-4272(2010) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION IN THE MSL COMPLEX, FUNCTION OF THE MSL COMPLEX. |
| [12] | "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis." Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M. Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-367, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [13] | "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation." Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B. Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-400, MASS SPECTROMETRY. |
| [14] | "Corecognition of DNA and a methylated histone tail by the MSL3 chromodomain." Kim D., Blus B.J., Chandra V., Huang P., Rastinejad F., Khorasanizadeh S. Nat. Struct. Mol. Biol. 17:1027-1029(2010) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.35 ANGSTROMS) OF 1-101 IN COMPLEX WITH DNA AND HISTONE H4, MUTAGENESIS OF HIS-55; TRP-59 AND ARG-65, FUNCTION. |
| [15] | "Structural and biochemical studies on the chromo-barrel domain of male specific lethal 3 (MSL3) reveal a binding preference for mono- or dimethyllysine 20 on histone H4." Moore S.A., Ferhatoglu Y., Jia Y., Al-Jiab R.A., Scott M.J. J. Biol. Chem. 285:40879-40890(2010) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.5 ANGSTROMS) OF 2-93, MUTAGENESIS OF TYR-31, FUNCTION. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AF117065 mRNA. Translation: AAD38499.1. AK025642 mRNA. No translation available. AK289780 mRNA. Translation: BAF82469.1. AK300814 mRNA. Translation: BAG62470.1. AC004554 Genomic DNA. No translation available. CH471074 Genomic DNA. Translation: EAW98799.1. CH471074 Genomic DNA. Translation: EAW98801.1. BC031210 mRNA. Translation: AAH31210.1. AL050178 mRNA. Translation: CAB43308.1. AL713667 mRNA. Translation: CAD28473.1. | ||||||||||||||||||||||||
| IPI | IPI00297145. IPI00375604. IPI00377170. IPI00641297. | ||||||||||||||||||||||||
| PIR | T08795. | ||||||||||||||||||||||||
| RefSeq | NP_001180199.1. NM_001193270.1. NP_006791.2. NM_006800.3. NP_523352.1. NM_078628.1. NP_523353.2. NM_078629.3. | ||||||||||||||||||||||||
| UniGene | Hs.655288. | ||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||||||||
| ProteinModelPortal | Q8N5Y2. | ||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||
| DIP | DIP-56857N. | ||||||||||||||||||||||||
| IntAct | Q8N5Y2. 3 interactions. | ||||||||||||||||||||||||
| STRING | 9606.ENSP00000312244. | ||||||||||||||||||||||||
PTM databases | |||||||||||||||||||||||||
| PhosphoSite | Q8N5Y2. | ||||||||||||||||||||||||
Polymorphism databases | |||||||||||||||||||||||||
| DMDM | 32171482. | ||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||
| PaxDb | Q8N5Y2. | ||||||||||||||||||||||||
| PRIDE | Q8N5Y2. | ||||||||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||||||||
| DNASU | 10943. | ||||||||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||
| Ensembl | ENST00000312196; ENSP00000312244; ENSG00000005302. ENST00000337339; ENSP00000338078; ENSG00000005302. ENST00000380693; ENSP00000370069; ENSG00000005302. ENST00000398527; ENSP00000381538; ENSG00000005302. | ||||||||||||||||||||||||
| GeneID | 10943. | ||||||||||||||||||||||||
| KEGG | hsa:10943. | ||||||||||||||||||||||||
| UCSC | uc004cuw.3. human. | ||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||
| CTD | 10943. | ||||||||||||||||||||||||
| GeneCards | GC0XP011776. | ||||||||||||||||||||||||
| HGNC | HGNC:7370. MSL3. | ||||||||||||||||||||||||
| HPA | HPA034535. HPA034536. | ||||||||||||||||||||||||
| MIM | 300609. gene. | ||||||||||||||||||||||||
| neXtProt | NX_Q8N5Y2. | ||||||||||||||||||||||||
| PharmGKB | PA164723161. | ||||||||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||
| eggNOG | NOG293760. | ||||||||||||||||||||||||
| HOGENOM | HOG000293161. | ||||||||||||||||||||||||
| HOVERGEN | HBG052511. | ||||||||||||||||||||||||
| InParanoid | Q8N5Y2. | ||||||||||||||||||||||||
| OMA | GMKFKFH. | ||||||||||||||||||||||||
| OrthoDB | EOG4X0MS9. | ||||||||||||||||||||||||
| PhylomeDB | Q8N5Y2. | ||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||
| ArrayExpress | Q8N5Y2. | ||||||||||||||||||||||||
| Bgee | Q8N5Y2. | ||||||||||||||||||||||||
| CleanEx | HS_MSL3. | ||||||||||||||||||||||||
| Genevestigator | Q8N5Y2. | ||||||||||||||||||||||||
| GermOnline | ENSG00000005302. Homo sapiens. | ||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||
| InterPro | IPR000953. Chromo_domain/shadow. IPR016197. Chromodomain-like. IPR008676. MRG. IPR026541. MRG_dom. IPR025995. Tudor-knot. [Graphical view] | ||||||||||||||||||||||||
| PANTHER | PTHR10880. PTHR10880. 1 hit. | ||||||||||||||||||||||||
| Pfam | PF05712. MRG. 1 hit. PF11717. Tudor-knot. 1 hit. [Graphical view] | ||||||||||||||||||||||||
| SMART | SM00298. CHROMO. 1 hit. [Graphical view] | ||||||||||||||||||||||||
| SUPFAM | SSF54160. Chromodomain-like. 1 hit. | ||||||||||||||||||||||||
| PROSITE | PS00598. CHROMO_1. False negative. PS50013. CHROMO_2. False negative. PS51640. MRG. 1 hit. [Graphical view] | ||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||
Other | |||||||||||||||||||||||||
| ChiTaRS | MSL3. human. | ||||||||||||||||||||||||
| EvolutionaryTrace | Q8N5Y2. | ||||||||||||||||||||||||
| GenomeRNAi | 10943. | ||||||||||||||||||||||||
| NextBio | 35463804. | ||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||
Entry information
| Entry name | MS3L1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q8N5Y2 Secondary accession number(s): A6NCU2 Q9Y5Z8 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome X Human chromosome X: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
