Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

39S ribosomal protein L50, mitochondrial

Gene

MRPL50

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

GO - Biological processi

Keywordsi

Molecular functionRibonucleoprotein, Ribosomal protein

Enzyme and pathway databases

ReactomeiR-HSA-5368286 Mitochondrial translation initiation
R-HSA-5389840 Mitochondrial translation elongation
R-HSA-5419276 Mitochondrial translation termination

Names & Taxonomyi

Protein namesi
Recommended name:
39S ribosomal protein L50, mitochondrial
Short name:
L50mt
Short name:
MRP-L50
Alternative name(s):
Mitochondrial large ribosomal subunit protein mL501 Publication
Gene namesi
Name:MRPL50
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 9

Organism-specific databases

EuPathDBiHostDB:ENSG00000136897.7
HGNCiHGNC:16654 MRPL50
MIMi611854 gene
neXtProtiNX_Q8N5N7

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Mitochondrion

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000136897
PharmGKBiPA30983

Polymorphism and mutation databases

BioMutaiMRPL50
DMDMi118573685

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002616591 – 15839S ribosomal protein L50, mitochondrialAdd BLAST158

Proteomic databases

EPDiQ8N5N7
MaxQBiQ8N5N7
PaxDbiQ8N5N7
PeptideAtlasiQ8N5N7
PRIDEiQ8N5N7
TopDownProteomicsiQ8N5N7-1 [Q8N5N7-1]

PTM databases

iPTMnetiQ8N5N7
PhosphoSitePlusiQ8N5N7

Expressioni

Gene expression databases

BgeeiENSG00000136897
CleanExiHS_MRPL50
GenevisibleiQ8N5N7 HS

Organism-specific databases

HPAiHPA022925

Interactioni

Subunit structurei

Component of the mitochondrial large ribosomal subunit (mt-LSU). Mature mammalian 55S mitochondrial ribosomes consist of a small (28S) and a large (39S) subunit. The 28S small subunit contains a 12S ribosomal RNA (12S mt-rRNA) and 30 different proteins. The 39S large subunit contains a 16S rRNA (16S mt-rRNA), a copy of mitochondrial valine transfer RNA (mt-tRNA(Val)), which plays an integral structural role, and 52 different proteins.2 Publications

Protein-protein interaction databases

BioGridi120021, 111 interactors
CORUMiQ8N5N7
IntActiQ8N5N7, 95 interactors
MINTiQ8N5N7
STRINGi9606.ENSP00000363999

Structurei

Secondary structure

1158
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Helixi66 – 77Combined sources12
Helixi86 – 88Combined sources3
Helixi94 – 108Combined sources15
Turni114 – 119Combined sources6
Helixi123 – 129Combined sources7
Helixi139 – 143Combined sources5
Beta strandi152 – 154Combined sources3

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
3J7Yelectron microscopy3.40h1-158[»]
3J9Melectron microscopy3.50h1-158[»]
5OOLelectron microscopy3.06h1-158[»]
5OOMelectron microscopy3.03h1-158[»]
ProteinModelPortaliQ8N5N7
SMRiQ8N5N7
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Phylogenomic databases

eggNOGiENOG410J127 Eukaryota
ENOG4111QY3 LUCA
GeneTreeiENSGT00390000004279
HOGENOMiHOG000231606
HOVERGENiHBG093900
InParanoidiQ8N5N7
KOiK17431
OMAiAPRREFW
OrthoDBiEOG091G02KC
PhylomeDBiQ8N5N7
TreeFamiTF105895

Family and domain databases

InterProiView protein in InterPro
IPR018305 Ribosomal_L50_mt
PfamiView protein in Pfam
PF10501 Ribosomal_L50, 1 hit

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8N5N7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAARSVSGIT RRVFMWTVSG TPCREFWSRF RKEKEPVVVE TVEEKKEPIL
60 70 80 90 100
VCPPLRSRAY TPPEDLQSRL ESYVKEVFGS SLPSNWQDIS LEDSRLKFNL
110 120 130 140 150
LAHLADDLGH VVPNSRLHQM CRVRDVLDFY NVPIQDRSKF DELSASNLPP

NLKITWSY
Length:158
Mass (Da):18,325
Last modified:November 28, 2006 - v2
Checksum:iF8FD54809C08EF0E
GO
Isoform 2 (identifier: Q8N5N7-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     123-158: VRDVLDFYNVPIQDRSKFDELSASNLPPNLKITWSY → GYSFEEGKIQLGI

Note: No experimental confirmation available.
Show »
Length:135
Mass (Da):15,524
Checksum:iD242D9E74F11E062
GO

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_029474127L → F1 PublicationCorresponds to variant dbSNP:rs8131Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_056091123 – 158VRDVL…ITWSY → GYSFEEGKIQLGI in isoform 2. 1 PublicationAdd BLAST36

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK000500 mRNA Translation: BAA91207.1
AK025643 mRNA Translation: BAB15200.1
AK295521 mRNA Translation: BAH12094.1
AL353621 Genomic DNA No translation available.
BC032008 mRNA Translation: AAH32008.1
CCDSiCCDS6753.1 [Q8N5N7-1]
RefSeqiNP_061924.1, NM_019051.2 [Q8N5N7-1]
UniGeneiHs.288224
Hs.713644

Genome annotation databases

EnsembliENST00000374865; ENSP00000363999; ENSG00000136897 [Q8N5N7-1]
GeneIDi54534
KEGGihsa:54534
UCSCiuc004bbe.3 human [Q8N5N7-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiRM50_HUMAN
AccessioniPrimary (citable) accession number: Q8N5N7
Secondary accession number(s): B7Z358, Q5T7E0, Q9NX15
Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 28, 2006
Last sequence update: November 28, 2006
Last modified: May 23, 2018
This is version 124 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 9
    Human chromosome 9: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. Ribosomal proteins
    Ribosomal proteins families and list of entries
  7. SIMILARITY comments
    Index of protein domains and families

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health