Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

39S ribosomal protein L50, mitochondrial

Gene

MRPL50

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at protein leveli

Functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Ribonucleoprotein, Ribosomal protein

Enzyme and pathway databases

ReactomeiR-HSA-5368286. Mitochondrial translation initiation.
R-HSA-5389840. Mitochondrial translation elongation.
R-HSA-5419276. Mitochondrial translation termination.

Names & Taxonomyi

Protein namesi
Recommended name:
39S ribosomal protein L50, mitochondrial
Short name:
L50mt
Short name:
MRP-L50
Gene namesi
Name:MRPL50
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 9

Organism-specific databases

HGNCiHGNC:16654. MRPL50.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Mitochondrion

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000136897.
PharmGKBiPA30983.

Polymorphism and mutation databases

BioMutaiMRPL50.
DMDMi118573685.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002616591 – 15839S ribosomal protein L50, mitochondrialAdd BLAST158

Proteomic databases

EPDiQ8N5N7.
MaxQBiQ8N5N7.
PaxDbiQ8N5N7.
PeptideAtlasiQ8N5N7.
PRIDEiQ8N5N7.
TopDownProteomicsiQ8N5N7-1. [Q8N5N7-1]

PTM databases

iPTMnetiQ8N5N7.
PhosphoSitePlusiQ8N5N7.

Expressioni

Gene expression databases

BgeeiENSG00000136897.
CleanExiHS_MRPL50.
GenevisibleiQ8N5N7. HS.

Organism-specific databases

HPAiHPA022925.
HPA056854.

Interactioni

Subunit structurei

Component of the mitochondrial ribosome large subunit (39S) which comprises a 16S rRNA and about 50 distinct proteins.2 Publications

Protein-protein interaction databases

BioGridi120021. 108 interactors.
IntActiQ8N5N7. 88 interactors.
STRINGi9606.ENSP00000363999.

Structurei

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
3J7Yelectron microscopy3.40h1-158[»]
3J9Melectron microscopy3.50h1-158[»]
ProteinModelPortaliQ8N5N7.
SMRiQ8N5N7.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Phylogenomic databases

eggNOGiENOG410J127. Eukaryota.
ENOG4111QY3. LUCA.
GeneTreeiENSGT00390000004279.
HOGENOMiHOG000231606.
HOVERGENiHBG093900.
InParanoidiQ8N5N7.
KOiK17431.
OMAiTYIPPED.
OrthoDBiEOG091G02KC.
PhylomeDBiQ8N5N7.
TreeFamiTF105895.

Family and domain databases

InterProiIPR018305. Ribosomal_L50_mt.
[Graphical view]
PfamiPF10501. Ribosomal_L50. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8N5N7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAARSVSGIT RRVFMWTVSG TPCREFWSRF RKEKEPVVVE TVEEKKEPIL
60 70 80 90 100
VCPPLRSRAY TPPEDLQSRL ESYVKEVFGS SLPSNWQDIS LEDSRLKFNL
110 120 130 140 150
LAHLADDLGH VVPNSRLHQM CRVRDVLDFY NVPIQDRSKF DELSASNLPP

NLKITWSY
Length:158
Mass (Da):18,325
Last modified:November 28, 2006 - v2
Checksum:iF8FD54809C08EF0E
GO
Isoform 2 (identifier: Q8N5N7-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     123-158: VRDVLDFYNVPIQDRSKFDELSASNLPPNLKITWSY → GYSFEEGKIQLGI

Note: No experimental confirmation available.
Show »
Length:135
Mass (Da):15,524
Checksum:iD242D9E74F11E062
GO

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_029474127L → F.1 PublicationCorresponds to variant rs8131dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_056091123 – 158VRDVL…ITWSY → GYSFEEGKIQLGI in isoform 2. 1 PublicationAdd BLAST36

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK000500 mRNA. Translation: BAA91207.1.
AK025643 mRNA. Translation: BAB15200.1.
AK295521 mRNA. Translation: BAH12094.1.
AL353621 Genomic DNA. Translation: CAI14610.1.
BC032008 mRNA. Translation: AAH32008.1.
CCDSiCCDS6753.1. [Q8N5N7-1]
RefSeqiNP_061924.1. NM_019051.2. [Q8N5N7-1]
UniGeneiHs.288224.
Hs.713644.

Genome annotation databases

EnsembliENST00000374865; ENSP00000363999; ENSG00000136897. [Q8N5N7-1]
GeneIDi54534.
KEGGihsa:54534.
UCSCiuc004bbe.3. human. [Q8N5N7-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK000500 mRNA. Translation: BAA91207.1.
AK025643 mRNA. Translation: BAB15200.1.
AK295521 mRNA. Translation: BAH12094.1.
AL353621 Genomic DNA. Translation: CAI14610.1.
BC032008 mRNA. Translation: AAH32008.1.
CCDSiCCDS6753.1. [Q8N5N7-1]
RefSeqiNP_061924.1. NM_019051.2. [Q8N5N7-1]
UniGeneiHs.288224.
Hs.713644.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
3J7Yelectron microscopy3.40h1-158[»]
3J9Melectron microscopy3.50h1-158[»]
ProteinModelPortaliQ8N5N7.
SMRiQ8N5N7.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi120021. 108 interactors.
IntActiQ8N5N7. 88 interactors.
STRINGi9606.ENSP00000363999.

PTM databases

iPTMnetiQ8N5N7.
PhosphoSitePlusiQ8N5N7.

Polymorphism and mutation databases

BioMutaiMRPL50.
DMDMi118573685.

Proteomic databases

EPDiQ8N5N7.
MaxQBiQ8N5N7.
PaxDbiQ8N5N7.
PeptideAtlasiQ8N5N7.
PRIDEiQ8N5N7.
TopDownProteomicsiQ8N5N7-1. [Q8N5N7-1]

Protocols and materials databases

DNASUi54534.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000374865; ENSP00000363999; ENSG00000136897. [Q8N5N7-1]
GeneIDi54534.
KEGGihsa:54534.
UCSCiuc004bbe.3. human. [Q8N5N7-1]

Organism-specific databases

CTDi54534.
GeneCardsiMRPL50.
HGNCiHGNC:16654. MRPL50.
HPAiHPA022925.
HPA056854.
MIMi611854. gene.
neXtProtiNX_Q8N5N7.
OpenTargetsiENSG00000136897.
PharmGKBiPA30983.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410J127. Eukaryota.
ENOG4111QY3. LUCA.
GeneTreeiENSGT00390000004279.
HOGENOMiHOG000231606.
HOVERGENiHBG093900.
InParanoidiQ8N5N7.
KOiK17431.
OMAiTYIPPED.
OrthoDBiEOG091G02KC.
PhylomeDBiQ8N5N7.
TreeFamiTF105895.

Enzyme and pathway databases

ReactomeiR-HSA-5368286. Mitochondrial translation initiation.
R-HSA-5389840. Mitochondrial translation elongation.
R-HSA-5419276. Mitochondrial translation termination.

Miscellaneous databases

GenomeRNAii54534.
PROiQ8N5N7.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000136897.
CleanExiHS_MRPL50.
GenevisibleiQ8N5N7. HS.

Family and domain databases

InterProiIPR018305. Ribosomal_L50_mt.
[Graphical view]
PfamiPF10501. Ribosomal_L50. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiRM50_HUMAN
AccessioniPrimary (citable) accession number: Q8N5N7
Secondary accession number(s): B7Z358, Q5T7E0, Q9NX15
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 28, 2006
Last sequence update: November 28, 2006
Last modified: November 30, 2016
This is version 112 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 9
    Human chromosome 9: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.