Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Uncharacterized protein C3orf22

Gene

C3orf22

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 1 out of 5-Experimental evidence at transcript leveli

Functioni

Enzyme and pathway databases

BioCyciZFISH:ENSG00000180697-MONOMER.

Names & Taxonomyi

Protein namesi
Recommended name:
Uncharacterized protein C3orf22
Gene namesi
Name:C3orf22
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 3

Organism-specific databases

HGNCiHGNC:28534. C3orf22.

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000180697.
PharmGKBiPA142672383.

Polymorphism and mutation databases

BioMutaiC3orf22.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002344301 – 141Uncharacterized protein C3orf22Add BLAST141

Proteomic databases

PaxDbiQ8N5N4.
PRIDEiQ8N5N4.

PTM databases

iPTMnetiQ8N5N4.
PhosphoSitePlusiQ8N5N4.

Expressioni

Gene expression databases

BgeeiENSG00000180697.
CleanExiHS_C3orf22.
GenevisibleiQ8N5N4. HS.

Organism-specific databases

HPAiHPA059199.

Structurei

3D structure databases

ProteinModelPortaliQ8N5N4.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Phylogenomic databases

eggNOGiENOG410J49B. Eukaryota.
ENOG4111ABC. LUCA.
GeneTreeiENSGT00390000004778.
HOGENOMiHOG000111360.
HOVERGENiHBG081005.
InParanoidiQ8N5N4.
OMAiCNLWELK.
OrthoDBiEOG091G11Z6.
PhylomeDBiQ8N5N4.
TreeFamiTF338341.

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8N5N4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MDSSACKKSH QSKKWRIQAQ ENFAKKFPYR LSWLTEPDPE PLQPWEVTND
60 70 80 90 100
SNTVQLPLQK RLVPTRSIPV RGLGAPDFTS PSGSCPAPLP APSPPPLCNL
110 120 130 140
WELKLLSRRF PRQLAFLLST RHTEAACPQT SKAAGLSRGL S
Length:141
Mass (Da):15,686
Last modified:October 1, 2002 - v1
Checksum:iFD27529309C1261A
GO
Isoform 2 (identifier: Q8N5N4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     73-141: LGAPDFTSPS...KAAGLSRGLS → VGVRIKKSMNVTSRTLSQMYTHTGKWAPFH

Note: No experimental confirmation available.
Show »
Length:102
Mass (Da):11,864
Checksum:iFB7F22F5CCD187EB
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_05690273 – 141LGAPD…SRGLS → VGVRIKKSMNVTSRTLSQMY THTGKWAPFH in isoform 2. 1 PublicationAdd BLAST69

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK097841 mRNA. Translation: BAG53541.1.
AC024558 Genomic DNA. No translation available.
BC032025 mRNA. Translation: AAH32025.1.
CCDSiCCDS3040.1. [Q8N5N4-1]
RefSeqiNP_689746.1. NM_152533.2. [Q8N5N4-1]
XP_016861240.1. XM_017005751.1. [Q8N5N4-1]
XP_016861241.1. XM_017005752.1. [Q8N5N4-1]
XP_016861242.1. XM_017005753.1. [Q8N5N4-2]
UniGeneiHs.178210.

Genome annotation databases

EnsembliENST00000318225; ENSP00000316644; ENSG00000180697. [Q8N5N4-1]
ENST00000505070; ENSP00000422064; ENSG00000180697. [Q8N5N4-2]
GeneIDi152065.
KEGGihsa:152065.
UCSCiuc003ejb.4. human. [Q8N5N4-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK097841 mRNA. Translation: BAG53541.1.
AC024558 Genomic DNA. No translation available.
BC032025 mRNA. Translation: AAH32025.1.
CCDSiCCDS3040.1. [Q8N5N4-1]
RefSeqiNP_689746.1. NM_152533.2. [Q8N5N4-1]
XP_016861240.1. XM_017005751.1. [Q8N5N4-1]
XP_016861241.1. XM_017005752.1. [Q8N5N4-1]
XP_016861242.1. XM_017005753.1. [Q8N5N4-2]
UniGeneiHs.178210.

3D structure databases

ProteinModelPortaliQ8N5N4.
ModBaseiSearch...
MobiDBiSearch...

PTM databases

iPTMnetiQ8N5N4.
PhosphoSitePlusiQ8N5N4.

Polymorphism and mutation databases

BioMutaiC3orf22.

Proteomic databases

PaxDbiQ8N5N4.
PRIDEiQ8N5N4.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000318225; ENSP00000316644; ENSG00000180697. [Q8N5N4-1]
ENST00000505070; ENSP00000422064; ENSG00000180697. [Q8N5N4-2]
GeneIDi152065.
KEGGihsa:152065.
UCSCiuc003ejb.4. human. [Q8N5N4-1]

Organism-specific databases

CTDi152065.
GeneCardsiC3orf22.
HGNCiHGNC:28534. C3orf22.
HPAiHPA059199.
neXtProtiNX_Q8N5N4.
OpenTargetsiENSG00000180697.
PharmGKBiPA142672383.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410J49B. Eukaryota.
ENOG4111ABC. LUCA.
GeneTreeiENSGT00390000004778.
HOGENOMiHOG000111360.
HOVERGENiHBG081005.
InParanoidiQ8N5N4.
OMAiCNLWELK.
OrthoDBiEOG091G11Z6.
PhylomeDBiQ8N5N4.
TreeFamiTF338341.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000180697-MONOMER.

Miscellaneous databases

GenomeRNAii152065.
PROiQ8N5N4.

Gene expression databases

BgeeiENSG00000180697.
CleanExiHS_C3orf22.
GenevisibleiQ8N5N4. HS.

Family and domain databases

ProtoNetiSearch...

Entry informationi

Entry nameiCC022_HUMAN
AccessioniPrimary (citable) accession number: Q8N5N4
Secondary accession number(s): B3KUS9
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 16, 2006
Last sequence update: October 1, 2002
Last modified: November 2, 2016
This is version 79 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.