Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Uncharacterized protein C3orf22

Gene

C3orf22

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at transcript leveli

Names & Taxonomyi

Protein namesi
Recommended name:
Uncharacterized protein C3orf22
Gene namesi
Name:C3orf22
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 3

Organism-specific databases

EuPathDBiHostDB:ENSG00000180697.8
HGNCiHGNC:28534 C3orf22
neXtProtiNX_Q8N5N4

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000180697
PharmGKBiPA142672383

Polymorphism and mutation databases

BioMutaiC3orf22

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002344301 – 141Uncharacterized protein C3orf22Add BLAST141

Proteomic databases

PaxDbiQ8N5N4
PRIDEiQ8N5N4

PTM databases

iPTMnetiQ8N5N4
PhosphoSitePlusiQ8N5N4

Expressioni

Gene expression databases

BgeeiENSG00000180697
CleanExiHS_C3orf22
GenevisibleiQ8N5N4 HS

Organism-specific databases

HPAiHPA059199

Structurei

3D structure databases

ProteinModelPortaliQ8N5N4
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Phylogenomic databases

eggNOGiENOG410J49B Eukaryota
ENOG4111ABC LUCA
GeneTreeiENSGT00390000004778
HOGENOMiHOG000111360
HOVERGENiHBG081005
InParanoidiQ8N5N4
OMAiCNLWELK
OrthoDBiEOG091G11Z6
PhylomeDBiQ8N5N4
TreeFamiTF338341

Family and domain databases

InterProiView protein in InterPro
IPR038782 C3orf22
PANTHERiPTHR37875 PTHR37875, 1 hit

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8N5N4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MDSSACKKSH QSKKWRIQAQ ENFAKKFPYR LSWLTEPDPE PLQPWEVTND
60 70 80 90 100
SNTVQLPLQK RLVPTRSIPV RGLGAPDFTS PSGSCPAPLP APSPPPLCNL
110 120 130 140
WELKLLSRRF PRQLAFLLST RHTEAACPQT SKAAGLSRGL S
Length:141
Mass (Da):15,686
Last modified:October 1, 2002 - v1
Checksum:iFD27529309C1261A
GO
Isoform 2 (identifier: Q8N5N4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     73-141: LGAPDFTSPS...KAAGLSRGLS → VGVRIKKSMNVTSRTLSQMYTHTGKWAPFH

Note: No experimental confirmation available.
Show »
Length:102
Mass (Da):11,864
Checksum:iFB7F22F5CCD187EB
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_05690273 – 141LGAPD…SRGLS → VGVRIKKSMNVTSRTLSQMY THTGKWAPFH in isoform 2. 1 PublicationAdd BLAST69

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK097841 mRNA Translation: BAG53541.1
AC024558 Genomic DNA No translation available.
BC032025 mRNA Translation: AAH32025.1
CCDSiCCDS3040.1 [Q8N5N4-1]
RefSeqiNP_689746.1, NM_152533.2 [Q8N5N4-1]
XP_016861240.1, XM_017005751.1 [Q8N5N4-1]
XP_016861241.1, XM_017005752.1 [Q8N5N4-1]
XP_016861242.1, XM_017005753.1 [Q8N5N4-2]
UniGeneiHs.178210

Genome annotation databases

EnsembliENST00000318225; ENSP00000316644; ENSG00000180697 [Q8N5N4-1]
ENST00000505070; ENSP00000422064; ENSG00000180697 [Q8N5N4-2]
GeneIDi152065
KEGGihsa:152065
UCSCiuc003ejb.4 human [Q8N5N4-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiCC022_HUMAN
AccessioniPrimary (citable) accession number: Q8N5N4
Secondary accession number(s): B3KUS9
Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 16, 2006
Last sequence update: October 1, 2002
Last modified: May 23, 2018
This is version 83 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health