Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Ubiquitin carboxyl-terminal hydrolase MINDY-1

Gene

MINDY1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Hydrolase that can specifically remove 'Lys-48'-linked conjugated ubiquitin from proteins. Has exodeubiquitinase activity and has a preference for long polyubiquitin chains. May play a regulatory role at the level of protein turnover.2 Publications

Catalytic activityi

Thiol-dependent hydrolysis of ester, thioester, amide, peptide and isopeptide bonds formed by the C-terminal Gly of ubiquitin (a 76-residue protein attached to proteins as an intracellular targeting signal).1 Publication

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Active sitei137Nucleophile1 Publication1
Active sitei319Proton acceptor1 Publication1
Sitei412Ubiquitin-binding1 Publication1
Sitei415 – 416Ubiquitin-binding1 Publication2
Sitei419Ubiquitin-binding1 Publication1

GO - Molecular functioni

  • cysteine-type carboxypeptidase activity Source: UniProtKB
  • K48-linked polyubiquitin modification-dependent protein binding Source: UniProtKB
  • Lys48-specific deubiquitinase activity Source: UniProtKB
  • thiol-dependent ubiquitin-specific protease activity Source: InterPro

Keywordsi

Molecular functionHydrolase, Protease, Thiol protease
Biological processUbl conjugation pathway

Names & Taxonomyi

Protein namesi
Recommended name:
Ubiquitin carboxyl-terminal hydrolase MINDY-11 Publication (EC:3.4.19.121 Publication)
Alternative name(s):
Deubiquitinating enzyme MINDY-11 Publication
Protein FAM63A
Gene namesi
Name:MINDY1Imported
Synonyms:FAM63A, KIAA1390
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

EuPathDBiHostDB:ENSG00000143409.15
HGNCiHGNC:25648 MINDY1
neXtProtiNX_Q8N5J2

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi131Q → A or E: Abolishes ubiquitin hydrolase activity. 1 Publication1
Mutagenesisi137C → A: Abolishes ubiquitin hydrolase activity. 1 Publication1
Mutagenesisi209D → A: Abolishes ubiquitin hydrolase activity. 1 Publication1
Mutagenesisi210V → A: Greatly impairs ubiquitin hydrolase activity. 1 Publication1
Mutagenesisi240W → A: Abolishes ubiquitin hydrolase activity. 1 Publication1
Mutagenesisi258Y → A: Abolishes ubiquitin hydrolase activity. 1 Publication1
Mutagenesisi263E → A: Greatly impairs ubiquitin hydrolase activity. 1 Publication1
Mutagenesisi263E → R: Abolishes ubiquitin hydrolase activity. 1 Publication1
Mutagenesisi315F → A: Abolishes ubiquitin hydrolase activity. 1 Publication1
Mutagenesisi319H → A: Abolishes ubiquitin hydrolase activity. 1 Publication1
Mutagenesisi396A → G: No effect on binding to 'Lys-48' tetraubiquitin chains. 1 Publication1
Mutagenesisi408L → A: No effect on binding to 'Lys-48' tetraubiquitin chains. 1 Publication1
Mutagenesisi411T → A: No effect on binding to 'Lys-48' tetraubiquitin chains. 1 Publication1
Mutagenesisi412D → A: Loss of binding to 'Lys-48' tetraubiquitin chains. 1 Publication1
Mutagenesisi413L → A: No effect on binding to 'Lys-48' tetraubiquitin chains. 1 Publication1
Mutagenesisi414E → A: No effect on binding to 'Lys-48' tetraubiquitin chains. 1 Publication1
Mutagenesisi415 – 416LA → AG: Decreased association with 'Lys-48'-linked conjugated ubiquitin. 1 Publication2
Mutagenesisi415L → A: Loss of binding to 'Lys-48' tetraubiquitin chains. 1 Publication1
Mutagenesisi416A → G or D: Loss of binding to 'Lys-48' tetraubiquitin chains. 1 Publication1
Mutagenesisi416A → S: No effect on binding to 'Lys-48' tetraubiquitin chains. 1 Publication1
Mutagenesisi418Q → A or K: No effect on binding to 'Lys-48' tetraubiquitin chains. 1 Publication1
Mutagenesisi419L → A: Loss of binding to 'Lys-48' tetraubiquitin chains. 1 Publication1
Mutagenesisi420Q → A: Loss of binding to 'Lys-48' tetraubiquitin chains. 1 Publication1
Mutagenesisi421Q → E or R: No effect on binding to 'Lys-48' tetraubiquitin chains. 1 Publication1
Mutagenesisi422E → A: No effect on binding to 'Lys-48' tetraubiquitin chains. 1 Publication1
Mutagenesisi423E → A: Loss of binding to 'Lys-48' tetraubiquitin chains. 1 Publication1
Mutagenesisi423E → EA, EAAA, EAAAAAA or EAAAAAAA: Loss of binding to 'Lys-48' tetraubiquitin chains. 1 Publication1
Mutagenesisi423Missing : Loss of binding to 'Lys-48' tetraubiquitin chains. 1 Publication1
Mutagenesisi424Y → A, D or E: Decreased binding to 'Lys-48' tetraubiquitin chains. 1 Publication1
Mutagenesisi424Y → F or W: No effect on binding to 'Lys-48' tetraubiquitin chains. 1 Publication1

Organism-specific databases

DisGeNETi55793
OpenTargetsiENSG00000143409
PharmGKBiPA142671872

Polymorphism and mutation databases

BioMutaiFAM63A
DMDMi311033379

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003440371 – 469Ubiquitin carboxyl-terminal hydrolase MINDY-1Add BLAST469

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei103PhosphoserineCombined sources1
Modified residuei441PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ8N5J2
PaxDbiQ8N5J2
PeptideAtlasiQ8N5J2
PRIDEiQ8N5J2
TopDownProteomicsiQ8N5J2-2 [Q8N5J2-2]

PTM databases

iPTMnetiQ8N5J2
PhosphoSitePlusiQ8N5J2

Expressioni

Gene expression databases

BgeeiENSG00000143409
CleanExiHS_FAM63A
ExpressionAtlasiQ8N5J2 baseline and differential
GenevisibleiQ8N5J2 HS

Organism-specific databases

HPAiHPA028351
HPA028358
HPA061086

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
FLJ13057Q53SE73EBI-372322,EBI-10172181

GO - Molecular functioni

  • K48-linked polyubiquitin modification-dependent protein binding Source: UniProtKB

Protein-protein interaction databases

BioGridi12090621 interactors.
IntActiQ8N5J2 5 interactors.
STRINGi9606.ENSP00000354669

Structurei

Secondary structure

1469
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Beta strandi113 – 121Combined sources9
Beta strandi124 – 129Combined sources6
Helixi137 – 148Combined sources12
Beta strandi160 – 162Combined sources3
Helixi163 – 174Combined sources12
Helixi188 – 206Combined sources19
Beta strandi208 – 210Combined sources3
Helixi224 – 231Combined sources8
Beta strandi236 – 239Combined sources4
Helixi247 – 253Combined sources7
Helixi258 – 270Combined sources13
Helixi274 – 289Combined sources16
Turni290 – 292Combined sources3
Helixi296 – 305Combined sources10
Beta strandi311 – 316Combined sources6
Beta strandi319 – 326Combined sources8
Beta strandi329 – 333Combined sources5
Helixi337 – 339Combined sources3
Beta strandi347 – 349Combined sources3
Beta strandi353 – 355Combined sources3
Helixi411 – 425Combined sources15

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
5JKNX-ray3.00A110-384[»]
5JQSX-ray2.65A110-384[»]
5MN9X-ray2.05C388-426[»]
ProteinModelPortaliQ8N5J2
SMRiQ8N5J2
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni388 – 426Ubiquitin-binding domain (UBD)1 PublicationAdd BLAST39

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi386 – 431Gln-richAdd BLAST46

Sequence similaritiesi

Belongs to the peptidase MINDY family. FAM63 subfamily.Curated

Phylogenomic databases

eggNOGiKOG2427 Eukaryota
ENOG41102GM LUCA
GeneTreeiENSGT00390000016607
HOVERGENiHBG054318
InParanoidiQ8N5J2
OMAiVIPENHE
OrthoDBiEOG091G0C4Y
PhylomeDBiQ8N5J2
TreeFamiTF314589

Family and domain databases

InterProiView protein in InterPro
IPR007518 MINDY
IPR033979 MINDY_domain
PANTHERiPTHR18063 PTHR18063, 1 hit
PfamiView protein in Pfam
PF04424 MINDY_DUB, 1 hit

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8N5J2-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MEYHQPEDPA PGKAGTAEAV IPENHEVLAG PDEHPQDTDA RDADGEARER
60 70 80 90 100
EPADQALLPS QCGDNLESPL PEASSAPPGP TLGTLPEVET IRACSMPQEL
110 120 130 140 150
PQSPRTRQPE PDFYCVKWIP WKGEQTPIIT QSTNGPCPLL AIMNILFLQW
160 170 180 190 200
KVKLPPQKEV ITSDELMAHL GNCLLSIKPQ EKSEGLQLNF QQNVDDAMTV
210 220 230 240 250
LPKLATGLDV NVRFTGVSDF EYTPECSVFD LLGIPLYHGW LVDPQSPEAV
260 270 280 290 300
RAVGKLSYNQ LVERIITCKH SSDTNLVTEG LIAEQFLETT AAQLTYHGLC
310 320 330 340 350
ELTAAAKEGE LSVFFRNNHF STMTKHKSHL YLLVTDQGFL QEEQVVWESL
360 370 380 390 400
HNVDGDSCFC DSDFHLSHSL GKGPGAEGGS GSPETQLQVD QDYLIALSLQ
410 420 430 440 450
QQQPRGPLGL TDLELAQQLQ QEEYQQQQAA QPVRMRTRVL SLQGRGATSG
460
RPAGERRQRP KHESDCILL
Length:469
Mass (Da):51,778
Last modified:November 2, 2010 - v2
Checksum:iFEB658BAF8A878C6
GO
Isoform 2 (identifier: Q8N5J2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-142: Missing.

Show »
Length:327
Mass (Da):36,458
Checksum:iA0B153B6B2217B7A
GO
Isoform 3 (identifier: Q8N5J2-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MLLGPPPFNESTKPSPSPCHSFASQAWLRQVPEVSKHLQCPSAKSLLTM

Show »
Length:517
Mass (Da):56,991
Checksum:i6BBA4F7A62BF16FD
GO
Isoform 4 (identifier: Q8N5J2-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-95: Missing.

Show »
Length:374
Mass (Da):41,833
Checksum:i49C3DA92F5491B1A
GO

Sequence cautioni

The sequence BAA92628 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti287L → P in BAA92104 (PubMed:14702039).Curated1
Sequence conflicti367S → R in BAA92104 (PubMed:14702039).Curated1
Isoform 3 (identifier: Q8N5J2-3)
Sequence conflicti44K → E in BAG63364 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_044541385T → K4 PublicationsCorresponds to variant dbSNP:rs2925741Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0347151 – 142Missing in isoform 2. 1 PublicationAdd BLAST142
Alternative sequenceiVSP_0370761 – 95Missing in isoform 4. 1 PublicationAdd BLAST95
Alternative sequenceiVSP_0370771M → MLLGPPPFNESTKPSPSPCH SFASQAWLRQVPEVSKHLQC PSAKSLLTM in isoform 3. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB037811 mRNA Translation: BAA92628.1 Different initiation.
AK002142 mRNA Translation: BAA92104.1
AK125493 mRNA Translation: BAG54206.1
AK125959 mRNA Translation: BAG54270.1
AK301946 mRNA Translation: BAG63364.1
AK303962 mRNA Translation: BAG64886.1
AL590133 Genomic DNA No translation available.
CH471121 Genomic DNA Translation: EAW53491.1
CH471121 Genomic DNA Translation: EAW53492.1
CH471121 Genomic DNA Translation: EAW53493.1
CH471121 Genomic DNA Translation: EAW53495.1
BC032321 mRNA Translation: AAH32321.1
CCDSiCCDS30854.1 [Q8N5J2-2]
CCDS53361.1 [Q8N5J2-3]
CCDS55635.1 [Q8N5J2-4]
CCDS976.1 [Q8N5J2-1]
RefSeqiNP_001035307.1, NM_001040217.2
NP_001156730.1, NM_001163258.1
NP_001156731.1, NM_001163259.1
NP_001156732.1, NM_001163260.1
NP_001306927.1, NM_001319998.1
NP_060849.2, NM_018379.4
XP_016857261.1, XM_017001772.1 [Q8N5J2-1]
XP_016857266.1, XM_017001777.1 [Q8N5J2-3]
UniGeneiHs.743952

Genome annotation databases

EnsembliENST00000312210; ENSP00000310923; ENSG00000143409 [Q8N5J2-2]
ENST00000361738; ENSP00000354669; ENSG00000143409 [Q8N5J2-3]
ENST00000361936; ENSP00000354814; ENSG00000143409 [Q8N5J2-1]
ENST00000493834; ENSP00000437174; ENSG00000143409 [Q8N5J2-4]
ENST00000622754; ENSP00000481304; ENSG00000143409 [Q8N5J2-1]
GeneIDi55793
KEGGihsa:55793
UCSCiuc001ewd.4 human [Q8N5J2-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiMINY1_HUMAN
AccessioniPrimary (citable) accession number: Q8N5J2
Secondary accession number(s): B3KWP4
, B3KWV8, B4DXF2, B4E1S4, D3DV09, J3KP53, Q5SZF0, Q9NUL9, Q9P2F7
Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 22, 2008
Last sequence update: November 2, 2010
Last modified: February 28, 2018
This is version 123 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome