Q8N5J2 (FA63A_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 68.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Protein FAM63A | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 469 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Sequence similarities | Belongs to the FAM63 family. |
| Sequence caution | The sequence BAA92628.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened. |
Ontologies
| Keywords | |
|---|---|
| Coding sequence diversity | Alternative splicing Polymorphism |
| PTM | Phosphoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| None. [Check GOA] | |
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| NAA38 | O95777 | 1 | EBI-372322,EBI-347779 |
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q8N5J2-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q8N5J2-2) The sequence of this isoform differs from the canonical sequence as follows: 1-142: Missing. | ||||||
| Isoform 3 (identifier: Q8N5J2-3) The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MLLGPPPFNESTKPSPSPCHSFASQAWLRQVPEVSKHLQCPSAESLLTM | ||||||
| Isoform 4 (identifier: Q8N5J2-4) The sequence of this isoform differs from the canonical sequence as follows: 1-95: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 469 | 469 | Protein FAM63A | PRO_0000344037 | |||||
Regions | |||||||||
| Compositional bias | 386 – 431 | 46 | Gln-rich | ||||||
Amino acid modifications | |||||||||
| Modified residue | 103 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 382 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 441 | 1 | Phosphoserine Ref.6 | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 142 | 142 | Missing in isoform 2. | VSP_034715 | |||||
| Alternative sequence | 1 – 95 | 95 | Missing in isoform 4. | VSP_037076 | |||||
| Alternative sequence | 1 | 1 | M → MLLGPPPFNESTKPSPSPCH SFASQAWLRQVPEVSKHLQC PSAESLLTM in isoform 3. | VSP_037077 | |||||
| Natural variant | 385 | 1 | T → K. Ref.1 Ref.2 Ref.4 Ref.5 Corresponds to variant rs2925741 [ dbSNP | Ensembl ]. | VAR_044541 | |||||
Experimental info | |||||||||
| Sequence conflict | 287 | 1 | L → P in BAA92104. Ref.2 | ||||||
| Sequence conflict | 367 | 1 | S → R in BAA92104. Ref.2 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| [1] | "Prediction of the coding sequences of unidentified human genes. XVI. The complete sequences of 150 new cDNA clones from brain which code for large proteins in vitro." Nagase T., Kikuno R., Ishikawa K., Hirosawa M., Ohara O. DNA Res. 7:65-73(2000) [PubMed: 10718198] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT LYS-385. Tissue: Brain. |
| [2] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2; 3 AND 4), VARIANT LYS-385. Tissue: Placenta, Testis and Trachea. |
| [3] | "The DNA sequence and biological annotation of human chromosome 1." Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K. Bentley D.R.Nature 441:315-321(2006) [PubMed: 16710414] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANT LYS-385. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT LYS-385. Tissue: Brain. |
| [6] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed: 18669648] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-441, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AB037811 mRNA. Translation: BAA92628.1. Different initiation. AK002142 mRNA. Translation: BAA92104.1. AK125493 mRNA. Translation: BAG54206.1. AK125959 mRNA. Translation: BAG54270.1. AK301946 mRNA. Translation: BAG63364.1. AK303962 mRNA. Translation: BAG64886.1. AL590133 Genomic DNA. Translation: CAI13336.1. CH471121 Genomic DNA. Translation: EAW53491.1. CH471121 Genomic DNA. Translation: EAW53492.1. CH471121 Genomic DNA. Translation: EAW53493.1. CH471121 Genomic DNA. Translation: EAW53495.1. BC032321 mRNA. Translation: AAH32321.1. |
| IPI | IPI00292905. IPI00413164. IPI00646860. IPI00929269. |
| RefSeq | NP_001035307.1. NM_001040217.2. NP_001156730.1. NM_001163258.1. NP_001156731.1. NM_001163259.1. NP_001156732.1. NM_001163260.1. NP_060849.2. NM_018379.4. |
| UniGene | Hs.3346. |
3D structure databases | |
| ProteinModelPortal | Q8N5J2. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q8N5J2. 2 interactions. |
PTM databases | |
| PhosphoSite | Q8N5J2. |
Polymorphism databases | |
| DMDM | 311033379. |
Proteomic databases | |
| PRIDE | Q8N5J2. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000361738; ENSP00000354669; ENSG00000143409. ENST00000361936; ENSP00000354814; ENSG00000143409. ENST00000368945; ENSP00000357941; ENSG00000143409. |
| GeneID | 55793. |
| KEGG | hsa:55793. |
Organism-specific databases | |
| CTD | 55793. |
| GeneCards | GC01M150965. |
| H-InvDB | HIX0001041. |
| HGNC | HGNC:25648. FAM63A. |
| HPA | HPA028351. HPA028358. |
| neXtProt | NX_Q8N5J2. |
| PharmGKB | PA142671872. |
| HUGE | Search... |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | prNOG06515. |
| GeneTree | ENSGT00390000016607. |
| HOVERGEN | HBG054318. |
| InParanoid | Q8N5J2. |
Gene expression databases | |
| ArrayExpress | Q8N5J2. |
| Bgee | Q8N5J2. |
| CleanEx | HS_FAM63A. |
| Genevestigator | Q8N5J2. |
Family and domain databases | |
| InterPro | IPR007518. DUF544. [Graphical view] |
| PANTHER | PTHR18063. DUF544. 1 hit. |
| Pfam | PF04424. DUF544. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 60909. |
Entry information
| Entry name | FA63A_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q8N5J2 Secondary accession number(s): B3KWP4 Q9P2F7 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 1 Human chromosome 1: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| SIMILARITY comments Index of protein domains and families |

Clusters with