Q8N5I3 (KCNRG_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 84.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Potassium channel regulatory protein Short name=Potassium channel regulator Alternative name(s): Protein CLLD4 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 272 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Inhibits potassium fluxes in cells. May regulate Kv1 family channel proteins by retaining a fraction of channels in endomembranes. Ref.1 Ref.6 |
| Subcellular location | |
| Tissue specificity | Ubiquitous in normal tissues and expressed in some tumor tissues. Ref.1 |
| Sequence similarities | Contains 1 BTB (POZ) domain. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Endoplasmic reticulum |
| Coding sequence diversity | Alternative splicing |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | protein homooligomerization Inferred from electronic annotation. Source: InterPro |
| Cellular_component | endoplasmic reticulum Inferred from electronic annotation. Source: UniProtKB-SubCell |
| Complete GO annotation... | |
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| itself | 3 | EBI-745755,EBI-745755 |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q8N5I3-1) Also known as: B; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q8N5I3-2) Also known as: A; The sequence of this isoform differs from the canonical sequence as follows: 194-229: YVSIKPDNRKLANGTNVLGLLIDTLLKEGFHLVSTR → LVCNGVISAHHNLRLWGSSDSPASASRVAGITGMFL 230-272: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 272 | 272 | Potassium channel regulatory protein | PRO_0000238945 | |||||
Regions | |||||||||
| Domain | 5 – 106 | 102 | BTB | ||||||
Natural variations | |||||||||
| Alternative sequence | 194 – 229 | 36 | YVSIK…LVSTR → LVCNGVISAHHNLRLWGSSD SPASASRVAGITGMFL in isoform 2. | VSP_019018 | |||||
| Alternative sequence | 230 – 272 | 43 | Missing in isoform 2. | VSP_019021 | |||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "A new human gene KCNRG encoding potassium channel regulating protein is a cancer suppressor gene candidate located in 13q14.3." Ivanov D.V., Tyazhelova T.V., Lemonnier L., Kononenko N., Pestova A.A., Nikitin E.A., Prevarskaya N., Skryma R., Panchin Y.V., Yankovsky N.K., Baranova A.V. FEBS Lett. 539:156-160(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), TISSUE SPECIFICITY, FUNCTION. |
| [2] | "Cloning of spliced CLLD4 gene transcripts." Skoldberg F., Alimohammadi M., Hedstrand H., Kampe O. Submitted (DEC-2002) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2). Tissue: Lung. |
| [3] | "The DNA sequence and analysis of human chromosome 13." Dunham A., Matthews L.H., Burton J., Ashurst J.L., Howe K.L., Ashcroft K.J., Beare D.M., Burford D.C., Hunt S.E., Griffiths-Jones S., Jones M.C., Keenan S.J., Oliver K., Scott C.E., Ainscough R., Almeida J.P., Ambrose K.D., Andrews D.T. Ross M.T.Nature 428:522-528(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2). Tissue: Lung. |
| [6] | "Potassium channel regulator KCNRG regulates surface expression of Shaker-type potassium channels." Usman H., Mathew M.K. Biochem. Biophys. Res. Commun. 391:1301-1305(2010) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, SUBCELLULAR LOCATION. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AY129653 mRNA. Translation: AAN06090.1. AY129654 mRNA. Translation: AAN06091.1. AY169387 mRNA. Translation: AAO11777.1. AY169388 mRNA. Translation: AAO11778.1. AY190921 mRNA. Translation: AAO27464.1. AY190922 mRNA. Translation: AAO27465.1. AL137060 Genomic DNA. Translation: CAM17621.1. AL137060 Genomic DNA. Translation: CAM17622.1. CH471075 Genomic DNA. Translation: EAX08849.1. CH471075 Genomic DNA. Translation: EAX08850.1. BC020887 mRNA. Translation: AAH20887.1. BC032343 mRNA. Translation: AAH32343.1. |
| IPI | IPI00166859. IPI00216656. IPI00759536. |
| RefSeq | NP_775876.1. NM_173605.1. NP_955751.1. NM_199464.2. |
| UniGene | Hs.436922. Hs.660161. |
3D structure databases | |
| ProteinModelPortal | Q8N5I3. |
| SMR | Q8N5I3. Positions 2-206. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q8N5I3. 7 interactions. |
| MINT | MINT-1460322. |
| STRING | 9606.ENSP00000324191. |
PTM databases | |
| PhosphoSite | Q8N5I3. |
Polymorphism databases | |
| DMDM | 74729005. |
Proteomic databases | |
| PaxDb | Q8N5I3. |
| PRIDE | Q8N5I3. |
Protocols and materials databases | |
| DNASU | 10206. 283518. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000312942; ENSP00000324191; ENSG00000198553. ENST00000360473; ENSP00000353661; ENSG00000198553. |
| GeneID | 283518. |
| KEGG | hsa:283518. |
| UCSC | uc001vdt.3. human. uc001vdu.3. human. |
Organism-specific databases | |
| CTD | 10206. 283518. |
| GeneCards | GC13P050589. |
| HGNC | HGNC:18893. KCNRG. |
| HPA | HPA001741. |
| MIM | 607947. gene. |
| neXtProt | NX_Q8N5I3. |
| PharmGKB | PA134924183. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG308813. |
| HOGENOM | HOG000230898. |
| HOVERGEN | HBG079982. |
| InParanoid | Q8N5I3. |
| OMA | ECYSFER. |
Gene expression databases | |
| Bgee | Q8N5I3. |
| CleanEx | HS_KCNRG. |
| Genevestigator | Q8N5I3. |
| GermOnline | ENSG00000198553. Homo sapiens. |
Family and domain databases | |
| Gene3D | 3.30.710.10. 1 hit. |
| InterPro | IPR000210. BTB/POZ-like. IPR011333. BTB/POZ_fold. IPR003131. T1-type_BTB. [Graphical view] |
| Pfam | PF02214. K_tetra. 1 hit. [Graphical view] |
| SMART | SM00225. BTB. 1 hit. [Graphical view] |
| SUPFAM | SSF54695. BTB/POZ_fold. 1 hit. |
| PROSITE | PS50097. BTB. False negative. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 38634. |
| SOURCE | Search... |
Entry information
| Entry name | KCNRG_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q8N5I3 Secondary accession number(s): A2A2X9 Q8N3Q9 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 13 Human chromosome 13: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
