Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Potassium channel regulatory protein

Gene

KCNRG

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

Inhibits potassium fluxes in cells. May regulate Kv1 family channel proteins by retaining a fraction of channels in endomembranes.2 Publications

GO - Molecular functioni

  • identical protein binding Source: IntAct

GO - Biological processi

Complete GO annotation...

Names & Taxonomyi

Protein namesi
Recommended name:
Potassium channel regulatory protein
Short name:
Potassium channel regulator
Alternative name(s):
Protein CLLD4
Gene namesi
Name:KCNRG
Synonyms:CLLD4
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 13

Organism-specific databases

HGNCiHGNC:18893. KCNRG.

Subcellular locationi

GO - Cellular componenti

  • endoplasmic reticulum Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Endoplasmic reticulum

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134924183.

Polymorphism and mutation databases

BioMutaiKCNRG.
DMDMi74729005.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 272272Potassium channel regulatory proteinPRO_0000238945Add
BLAST

Proteomic databases

PaxDbiQ8N5I3.
PeptideAtlasiQ8N5I3.
PRIDEiQ8N5I3.

PTM databases

iPTMnetiQ8N5I3.
PhosphoSiteiQ8N5I3.

Expressioni

Tissue specificityi

Ubiquitous in normal tissues and expressed in some tumor tissues.1 Publication

Gene expression databases

BgeeiENSG00000198553.
CleanExiHS_KCNRG.
GenevisibleiQ8N5I3. HS.

Organism-specific databases

HPAiHPA001741.

Interactioni

Subunit structurei

Can form homooligomers. Interacts with KCNA1 (via cytoplasmic N-terminal domain) and KCNA4.1 Publication

Binary interactionsi

WithEntry#Exp.IntActNotes
itself4EBI-745755,EBI-745755

GO - Molecular functioni

  • identical protein binding Source: IntAct

Protein-protein interaction databases

BioGridi129592. 7 interactions.
IntActiQ8N5I3. 9 interactions.
MINTiMINT-1460322.
STRINGi9606.ENSP00000324191.

Structurei

3D structure databases

ProteinModelPortaliQ8N5I3.
SMRiQ8N5I3. Positions 5-98.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini5 – 106102BTBAdd
BLAST

Sequence similaritiesi

Contains 1 BTB (POZ) domain.Curated

Phylogenomic databases

eggNOGiKOG2723. Eukaryota.
ENOG410Z155. LUCA.
GeneTreeiENSGT00760000119013.
HOGENOMiHOG000230898.
HOVERGENiHBG079982.
InParanoidiQ8N5I3.
OMAiRYVSIKP.
OrthoDBiEOG091G0EJ2.
PhylomeDBiQ8N5I3.
TreeFamiTF315332.

Family and domain databases

InterProiIPR000210. BTB/POZ_dom.
IPR011333. SKP1/BTB/POZ.
IPR003131. T1-type_BTB.
[Graphical view]
PfamiPF02214. BTB_2. 1 hit.
[Graphical view]
SMARTiSM00225. BTB. 1 hit.
[Graphical view]
SUPFAMiSSF54695. SSF54695. 1 hit.

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8N5I3-1) [UniParc]FASTAAdd to basket
Also known as: B

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSSQELVTLN VGGKIFTTRF STIKQFPASR LARMLDGRDQ EFKMVGGQIF
60 70 80 90 100
VDRDGDLFSF ILDFLRTHQL LLPTEFSDYL RLQREALFYE LRSLVDLLNP
110 120 130 140 150
YLLQPRPALV EVHFLSRNTQ AFFRVFGSCS KTIEMLTGRI TVFTEQPSAP
160 170 180 190 200
TWNGNFFPPQ MTLLPLPPQR PSYHDLVFQC GSDSTTDNQT GVRYVSIKPD
210 220 230 240 250
NRKLANGTNV LGLLIDTLLK EGFHLVSTRT VSSEDKTECY SFERIKSPEV
260 270
LITNETPKPE TIIIPEQSQI KK
Length:272
Mass (Da):31,048
Last modified:October 1, 2002 - v1
Checksum:i5018F55980F0BBA5
GO
Isoform 2 (identifier: Q8N5I3-2) [UniParc]FASTAAdd to basket
Also known as: A

The sequence of this isoform differs from the canonical sequence as follows:
     194-229: YVSIKPDNRKLANGTNVLGLLIDTLLKEGFHLVSTR → LVCNGVISAHHNLRLWGSSDSPASASRVAGITGMFL
     230-272: Missing.

Show »
Length:229
Mass (Da):25,857
Checksum:i9065D19F89DEFA58
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei194 – 22936YVSIK…LVSTR → LVCNGVISAHHNLRLWGSSD SPASASRVAGITGMFL in isoform 2. 3 PublicationsVSP_019018Add
BLAST
Alternative sequencei230 – 27243Missing in isoform 2. 3 PublicationsVSP_019021Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY129653 mRNA. Translation: AAN06090.1.
AY129654 mRNA. Translation: AAN06091.1.
AY169387 mRNA. Translation: AAO11777.1.
AY169388 mRNA. Translation: AAO11778.1.
AY190921 mRNA. Translation: AAO27464.1.
AY190922 mRNA. Translation: AAO27465.1.
AL137060 Genomic DNA. Translation: CAM17621.1.
AL137060 Genomic DNA. Translation: CAM17622.1.
CH471075 Genomic DNA. Translation: EAX08849.1.
CH471075 Genomic DNA. Translation: EAX08850.1.
BC020887 mRNA. Translation: AAH20887.1.
BC032343 mRNA. Translation: AAH32343.1.
CCDSiCCDS41889.1. [Q8N5I3-2]
CCDS9424.1. [Q8N5I3-1]
RefSeqiNP_775876.1. NM_173605.1. [Q8N5I3-1]
NP_955751.1. NM_199464.2. [Q8N5I3-2]
UniGeneiHs.660161.

Genome annotation databases

EnsembliENST00000312942; ENSP00000324191; ENSG00000198553. [Q8N5I3-1]
ENST00000360473; ENSP00000353661; ENSG00000198553. [Q8N5I3-2]
GeneIDi283518.
KEGGihsa:283518.
UCSCiuc001vdt.4. human. [Q8N5I3-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY129653 mRNA. Translation: AAN06090.1.
AY129654 mRNA. Translation: AAN06091.1.
AY169387 mRNA. Translation: AAO11777.1.
AY169388 mRNA. Translation: AAO11778.1.
AY190921 mRNA. Translation: AAO27464.1.
AY190922 mRNA. Translation: AAO27465.1.
AL137060 Genomic DNA. Translation: CAM17621.1.
AL137060 Genomic DNA. Translation: CAM17622.1.
CH471075 Genomic DNA. Translation: EAX08849.1.
CH471075 Genomic DNA. Translation: EAX08850.1.
BC020887 mRNA. Translation: AAH20887.1.
BC032343 mRNA. Translation: AAH32343.1.
CCDSiCCDS41889.1. [Q8N5I3-2]
CCDS9424.1. [Q8N5I3-1]
RefSeqiNP_775876.1. NM_173605.1. [Q8N5I3-1]
NP_955751.1. NM_199464.2. [Q8N5I3-2]
UniGeneiHs.660161.

3D structure databases

ProteinModelPortaliQ8N5I3.
SMRiQ8N5I3. Positions 5-98.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi129592. 7 interactions.
IntActiQ8N5I3. 9 interactions.
MINTiMINT-1460322.
STRINGi9606.ENSP00000324191.

PTM databases

iPTMnetiQ8N5I3.
PhosphoSiteiQ8N5I3.

Polymorphism and mutation databases

BioMutaiKCNRG.
DMDMi74729005.

Proteomic databases

PaxDbiQ8N5I3.
PeptideAtlasiQ8N5I3.
PRIDEiQ8N5I3.

Protocols and materials databases

DNASUi10206.
283518.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000312942; ENSP00000324191; ENSG00000198553. [Q8N5I3-1]
ENST00000360473; ENSP00000353661; ENSG00000198553. [Q8N5I3-2]
GeneIDi283518.
KEGGihsa:283518.
UCSCiuc001vdt.4. human. [Q8N5I3-1]

Organism-specific databases

CTDi283518.
GeneCardsiKCNRG.
HGNCiHGNC:18893. KCNRG.
HPAiHPA001741.
MIMi607947. gene.
neXtProtiNX_Q8N5I3.
PharmGKBiPA134924183.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG2723. Eukaryota.
ENOG410Z155. LUCA.
GeneTreeiENSGT00760000119013.
HOGENOMiHOG000230898.
HOVERGENiHBG079982.
InParanoidiQ8N5I3.
OMAiRYVSIKP.
OrthoDBiEOG091G0EJ2.
PhylomeDBiQ8N5I3.
TreeFamiTF315332.

Miscellaneous databases

GeneWikiiKCNRG.
GenomeRNAii283518.
PROiQ8N5I3.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000198553.
CleanExiHS_KCNRG.
GenevisibleiQ8N5I3. HS.

Family and domain databases

InterProiIPR000210. BTB/POZ_dom.
IPR011333. SKP1/BTB/POZ.
IPR003131. T1-type_BTB.
[Graphical view]
PfamiPF02214. BTB_2. 1 hit.
[Graphical view]
SMARTiSM00225. BTB. 1 hit.
[Graphical view]
SUPFAMiSSF54695. SSF54695. 1 hit.
ProtoNetiSearch...

Entry informationi

Entry nameiKCNRG_HUMAN
AccessioniPrimary (citable) accession number: Q8N5I3
Secondary accession number(s): A2A2X9
, Q0P6D0, Q8IU75, Q8N3Q9
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 30, 2006
Last sequence update: October 1, 2002
Last modified: September 7, 2016
This is version 111 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 13
    Human chromosome 13: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.