Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Membrane magnesium transporter 1

Gene

MMGT1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Mediates Mg2+ transport.By similarity

GO - Molecular functioni

GO - Biological processi

Keywordsi

Biological processTransport
LigandMagnesium

Enzyme and pathway databases

ReactomeiR-HSA-5223345 Miscellaneous transport and binding events

Protein family/group databases

TCDBi3.A.27.1.1 the c-terminal tail-anchored membrane protein biogenesis/ insertion complex-2 (tamp-b2) family

Names & Taxonomyi

Protein namesi
Recommended name:
Membrane magnesium transporter 1
Alternative name(s):
ER membrane protein complex subunit 5
Transmembrane protein 32
Gene namesi
Name:MMGT1
Synonyms:EMC5, TMEM32
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome X

Organism-specific databases

EuPathDBiHostDB:ENSG00000169446.5
HGNCiHGNC:28100 MMGT1
neXtProtiNX_Q8N4V1

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 4CytoplasmicCurated4
Transmembranei5 – 25HelicalSequence analysisAdd BLAST21
Topological domaini26 – 44LumenalCuratedAdd BLAST19
Transmembranei45 – 65HelicalSequence analysisAdd BLAST21
Topological domaini66 – 131CytoplasmicCuratedAdd BLAST66

Keywords - Cellular componenti

Endoplasmic reticulum, Endosome, Golgi apparatus, Membrane

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000169446
PharmGKBiPA164723074

Polymorphism and mutation databases

BioMutaiMMGT1
DMDMi74751006

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002864351 – 131Membrane magnesium transporter 1Add BLAST131

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei120PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ8N4V1
MaxQBiQ8N4V1
PaxDbiQ8N4V1
PeptideAtlasiQ8N4V1
PRIDEiQ8N4V1
ProteomicsDBi71978
71979 [Q8N4V1-2]
TopDownProteomicsiQ8N4V1-1 [Q8N4V1-1]

PTM databases

iPTMnetiQ8N4V1
PhosphoSitePlusiQ8N4V1
SwissPalmiQ8N4V1

Expressioni

Gene expression databases

BgeeiENSG00000169446
CleanExiHS_MMGT1
GenevisibleiQ8N4V1 HS

Organism-specific databases

HPAiHPA032037

Interactioni

Subunit structurei

Component of the ER membrane protein complex (EMC).1 Publication

Protein-protein interaction databases

BioGridi125021, 119 interactors
IntActiQ8N4V1, 102 interactors
STRINGi9606.ENSP00000306220

Structurei

3D structure databases

ProteinModelPortaliQ8N4V1
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG3918 Eukaryota
ENOG4111TZW LUCA
GeneTreeiENSGT00510000047104
HOGENOMiHOG000244123
HOVERGENiHBG105215
InParanoidiQ8N4V1
OMAiLENKSWE
OrthoDBiEOG091G0Y35
PhylomeDBiQ8N4V1
TreeFamiTF323267

Family and domain databases

InterProiView protein in InterPro
IPR018937 Magnesium_transport
PfamiView protein in Pfam
PF10270 MMgT, 1 hit

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8N4V1-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAPSLWKGLV GIGLFALAHA AFSAAQHRSY MRLTEKEDES LPIDIVLQTL
60 70 80 90 100
LAFAVTCYGI VHIAGEFKDM DATSELKNKT FDTLRNHPSF YVFNHRGRVL
110 120 130
FRPSDTANSS NQDALSSNTS LKLRKLESLR R
Length:131
Mass (Da):14,686
Last modified:October 1, 2002 - v1
Checksum:iDF6255A8172C6016
GO
Isoform 2 (identifier: Q8N4V1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MTPLGSGPPREASIAQPSGFSTTETLCAQDFSDVIFLRRADTRRWKKKQLRRPSLLLLGCCSFGIM

Note: No experimental confirmation available.
Show »
Length:196
Mass (Da):21,881
Checksum:i35F422071C402B5C
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0364881M → MTPLGSGPPREASIAQPSGF STTETLCAQDFSDVIFLRRA DTRRWKKKQLRRPSLLLLGC CSFGIM in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK295829 mRNA Translation: BAG58645.1
AK312409 mRNA Translation: BAG35322.1
AL732579 Genomic DNA No translation available.
AL953870 Genomic DNA No translation available.
CH471150 Genomic DNA Translation: EAW88483.1
CH471150 Genomic DNA Translation: EAW88485.1
BC033588 mRNA Translation: AAH33588.1
CCDSiCCDS14653.1 [Q8N4V1-1]
RefSeqiNP_001316929.1, NM_001330000.1 [Q8N4V1-1]
NP_775741.1, NM_173470.2 [Q8N4V1-1]
UniGeneiHs.110702

Genome annotation databases

EnsembliENST00000305963; ENSP00000306220; ENSG00000169446 [Q8N4V1-1]
GeneIDi93380
KEGGihsa:93380
UCSCiuc004ezi.2 human [Q8N4V1-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiMMGT1_HUMAN
AccessioniPrimary (citable) accession number: Q8N4V1
Secondary accession number(s): B2R625
, B4DIY3, D3DWG7, Q5JPP7
Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 1, 2007
Last sequence update: October 1, 2002
Last modified: June 20, 2018
This is version 124 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health