Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Membrane magnesium transporter 1

Gene

MMGT1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Mediates Mg2+ transport.By similarity

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

Transport

Keywords - Ligandi

Magnesium

Enzyme and pathway databases

ReactomeiR-HSA-5223345. Miscellaneous transport and binding events.

Names & Taxonomyi

Protein namesi
Recommended name:
Membrane magnesium transporter 1
Alternative name(s):
ER membrane protein complex subunit 5
Transmembrane protein 32
Gene namesi
Name:MMGT1
Synonyms:EMC5, TMEM32
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome X

Organism-specific databases

HGNCiHGNC:28100. MMGT1.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini1 – 44CytoplasmicCurated
Transmembranei5 – 2521HelicalSequence analysisAdd
BLAST
Topological domaini26 – 4419LumenalCuratedAdd
BLAST
Transmembranei45 – 6521HelicalSequence analysisAdd
BLAST
Topological domaini66 – 13166CytoplasmicCuratedAdd
BLAST

GO - Cellular componenti

  • early endosome Source: UniProtKB
  • early endosome membrane Source: UniProtKB-SubCell
  • ER membrane protein complex Source: UniProtKB
  • Golgi apparatus Source: UniProtKB
  • Golgi membrane Source: UniProtKB-SubCell
  • integral component of membrane Source: UniProtKB
  • membrane Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Endoplasmic reticulum, Endosome, Golgi apparatus, Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA164723074.

Polymorphism and mutation databases

BioMutaiMMGT1.
DMDMi74751006.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 131131Membrane magnesium transporter 1PRO_0000286435Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei120 – 1201PhosphoserineCombined sources

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ8N4V1.
MaxQBiQ8N4V1.
PaxDbiQ8N4V1.
PeptideAtlasiQ8N4V1.
PRIDEiQ8N4V1.
TopDownProteomicsiQ8N4V1-1. [Q8N4V1-1]

PTM databases

iPTMnetiQ8N4V1.
PhosphoSiteiQ8N4V1.
SwissPalmiQ8N4V1.

Expressioni

Gene expression databases

BgeeiENSG00000169446.
CleanExiHS_MMGT1.
GenevisibleiQ8N4V1. HS.

Organism-specific databases

HPAiHPA032037.

Interactioni

Subunit structurei

Component of the ER membrane protein complex (EMC).1 Publication

Protein-protein interaction databases

BioGridi125021. 117 interactions.
IntActiQ8N4V1. 102 interactions.
STRINGi9606.ENSP00000306220.

Structurei

3D structure databases

ProteinModelPortaliQ8N4V1.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG3918. Eukaryota.
ENOG4111TZW. LUCA.
GeneTreeiENSGT00510000047104.
HOGENOMiHOG000244123.
HOVERGENiHBG105215.
InParanoidiQ8N4V1.
OMAiMAFAVTC.
OrthoDBiEOG091G0Y35.
PhylomeDBiQ8N4V1.
TreeFamiTF323267.

Family and domain databases

InterProiIPR018937. Magnesium_transport.
[Graphical view]
PfamiPF10270. MMgT. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8N4V1-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAPSLWKGLV GIGLFALAHA AFSAAQHRSY MRLTEKEDES LPIDIVLQTL
60 70 80 90 100
LAFAVTCYGI VHIAGEFKDM DATSELKNKT FDTLRNHPSF YVFNHRGRVL
110 120 130
FRPSDTANSS NQDALSSNTS LKLRKLESLR R
Length:131
Mass (Da):14,686
Last modified:October 1, 2002 - v1
Checksum:iDF6255A8172C6016
GO
Isoform 2 (identifier: Q8N4V1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MTPLGSGPPREASIAQPSGFSTTETLCAQDFSDVIFLRRADTRRWKKKQLRRPSLLLLGCCSFGIM

Note: No experimental confirmation available.
Show »
Length:196
Mass (Da):21,881
Checksum:i35F422071C402B5C
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 11M → MTPLGSGPPREASIAQPSGF STTETLCAQDFSDVIFLRRA DTRRWKKKQLRRPSLLLLGC CSFGIM in isoform 2. 1 PublicationVSP_036488

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK295829 mRNA. Translation: BAG58645.1.
AK312409 mRNA. Translation: BAG35322.1.
AL732579, AL953870 Genomic DNA. Translation: CAI39920.2.
CH471150 Genomic DNA. Translation: EAW88483.1.
CH471150 Genomic DNA. Translation: EAW88485.1.
BC033588 mRNA. Translation: AAH33588.1.
CCDSiCCDS14653.1. [Q8N4V1-1]
RefSeqiNP_775741.1. NM_173470.1. [Q8N4V1-1]
UniGeneiHs.110702.

Genome annotation databases

EnsembliENST00000305963; ENSP00000306220; ENSG00000169446. [Q8N4V1-1]
GeneIDi93380.
KEGGihsa:93380.
UCSCiuc004ezi.2. human. [Q8N4V1-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK295829 mRNA. Translation: BAG58645.1.
AK312409 mRNA. Translation: BAG35322.1.
AL732579, AL953870 Genomic DNA. Translation: CAI39920.2.
CH471150 Genomic DNA. Translation: EAW88483.1.
CH471150 Genomic DNA. Translation: EAW88485.1.
BC033588 mRNA. Translation: AAH33588.1.
CCDSiCCDS14653.1. [Q8N4V1-1]
RefSeqiNP_775741.1. NM_173470.1. [Q8N4V1-1]
UniGeneiHs.110702.

3D structure databases

ProteinModelPortaliQ8N4V1.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi125021. 117 interactions.
IntActiQ8N4V1. 102 interactions.
STRINGi9606.ENSP00000306220.

PTM databases

iPTMnetiQ8N4V1.
PhosphoSiteiQ8N4V1.
SwissPalmiQ8N4V1.

Polymorphism and mutation databases

BioMutaiMMGT1.
DMDMi74751006.

Proteomic databases

EPDiQ8N4V1.
MaxQBiQ8N4V1.
PaxDbiQ8N4V1.
PeptideAtlasiQ8N4V1.
PRIDEiQ8N4V1.
TopDownProteomicsiQ8N4V1-1. [Q8N4V1-1]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000305963; ENSP00000306220; ENSG00000169446. [Q8N4V1-1]
GeneIDi93380.
KEGGihsa:93380.
UCSCiuc004ezi.2. human. [Q8N4V1-1]

Organism-specific databases

CTDi93380.
GeneCardsiMMGT1.
HGNCiHGNC:28100. MMGT1.
HPAiHPA032037.
neXtProtiNX_Q8N4V1.
PharmGKBiPA164723074.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG3918. Eukaryota.
ENOG4111TZW. LUCA.
GeneTreeiENSGT00510000047104.
HOGENOMiHOG000244123.
HOVERGENiHBG105215.
InParanoidiQ8N4V1.
OMAiMAFAVTC.
OrthoDBiEOG091G0Y35.
PhylomeDBiQ8N4V1.
TreeFamiTF323267.

Enzyme and pathway databases

ReactomeiR-HSA-5223345. Miscellaneous transport and binding events.

Miscellaneous databases

ChiTaRSiMMGT1. human.
GenomeRNAii93380.
PROiQ8N4V1.

Gene expression databases

BgeeiENSG00000169446.
CleanExiHS_MMGT1.
GenevisibleiQ8N4V1. HS.

Family and domain databases

InterProiIPR018937. Magnesium_transport.
[Graphical view]
PfamiPF10270. MMgT. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiMMGT1_HUMAN
AccessioniPrimary (citable) accession number: Q8N4V1
Secondary accession number(s): B2R625
, B4DIY3, D3DWG7, Q5JPP7
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 1, 2007
Last sequence update: October 1, 2002
Last modified: September 7, 2016
This is version 111 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome X
    Human chromosome X: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.