SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q8N4C6

- NIN_HUMAN

UniProt

Q8N4C6 - NIN_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Ninein
Gene
NIN, KIAA1565
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Centrosomal protein required in the positioning and anchorage of the microtubule minus-end in epithelial cells. May also act as a centrosome maturation factor. May play a role in microtubule nucleation. Overexpression does not perturb nucleation or elongation of microtubules but suppresses release of microtubules.1 Publication

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Nucleotide bindingi245 – 2528GTP Reviewed prediction
Nucleotide bindingi300 – 3045GTP Reviewed prediction
Nucleotide bindingi420 – 4234GTP Reviewed prediction

GO - Molecular functioni

  1. GTP binding Source: UniProtKB-KW
  2. calcium ion binding Source: InterPro
  3. protein binding Source: UniProtKB
Complete GO annotation...

GO - Biological processi

  1. centrosome localization Source: HGNC
  2. centrosome-templated microtubule nucleation Source: Ensembl
  3. microtubule anchoring at centrosome Source: Ensembl
Complete GO annotation...

Keywords - Ligandi

GTP-binding, Nucleotide-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Ninein
Short name:
hNinein
Alternative name(s):
Glycogen synthase kinase 3 beta-interacting protein
Short name:
GSK3B-interacting protein
Gene namesi
Name:NIN
Synonyms:KIAA1565
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 14

Organism-specific databases

HGNCiHGNC:14906. NIN.

Subcellular locationi

Cytoplasmcytoskeletonmicrotubule organizing centercentrosome
Note: Component of the core centrosome. Arranged in a tubular conformation with an open and a closed end within the centrosome. In the mother centrosome, it localizes at both ends of the centrosome tube, including the site of centrosome duplication, while in the daughter centrosome it is present only at the closed end. Requires PCM1 for centrosome localization.5 Publications

GO - Cellular componenti

  1. centriole Source: Ensembl
  2. centrosome Source: UniProtKB
  3. microtubule Source: UniProtKB-KW
  4. nucleolus Source: HPA
  5. spindle pole Source: MGI
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton, Microtubule

Pathology & Biotechi

Involvement in diseasei

Seckel syndrome 7 (SCKL7) [MIM:614851]: A rare autosomal recessive disorder characterized by proportionate dwarfism of prenatal onset associated with low birth weight, growth retardation, severe microcephaly with a bird-headed like appearance, and mental retardation.
Note: The disease is caused by mutations affecting the gene represented in this entry.1 Publication
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti1222 – 12221Q → R in SCKL7; does not disrupt protein expression or localization or affect mitotic functions in an obvious way. 1 Publication
Corresponds to variant rs187464517 [ dbSNP | Ensembl ].
VAR_069083
Natural varianti1709 – 17091N → S in SCKL7; does not disrupt protein expression or localization or affect mitotic functions in an obvious way. 1 Publication
VAR_069084

Keywords - Diseasei

Disease mutation, Dwarfism, Mental retardation

Organism-specific databases

MIMi614851. phenotype.
Orphaneti319675. Microcephalic primordial dwarfism, Dauber type.
PharmGKBiPA31630.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 20902090Ninein
PRO_0000096844Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei1550 – 15501Phosphoserine2 Publications

Post-translational modificationi

Phosphorylated by AURKA/Aurora kinase A and PKA kinases but not CK2 or AURKB/ Aurora kinase B.1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ8N4C6.
PaxDbiQ8N4C6.
PRIDEiQ8N4C6.

PTM databases

PhosphoSiteiQ8N4C6.

Expressioni

Tissue specificityi

Ubiquitous. Highly expressed in heart and skeletal muscle. Isoform 1 is more expressed than isoform 5.2 Publications

Developmental stagei

In interphase cells, it is localized in the centrosome. Decreases in metaphase and anaphase and reappears in telophase.1 Publication

Gene expression databases

ArrayExpressiQ8N4C6.
BgeeiQ8N4C6.
GenevestigatoriQ8N4C6.

Organism-specific databases

HPAiHPA005939.

Interactioni

Subunit structurei

Homooligomer. Interacts with GSK3B/GSK3-beta via its C-terminal domain. Interacts with C14ORF166, such interaction may prevent its phosphorylation by GSK3B. Interacts with AUNIP (via N-terminus). Identified in a complex with AUNIP and AURKA.4 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
C14orf166Q9Y2244EBI-1164022,EBI-1104547
GSK3BP498413EBI-1164022,EBI-373586

Protein-protein interaction databases

BioGridi119372. 8 interactions.
IntActiQ8N4C6. 6 interactions.
MINTiMINT-1175275.

Structurei

3D structure databases

ProteinModelPortaliQ8N4C6.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini8 – 4336EF-hand 1
Add
BLAST
Domaini42 – 7736EF-hand 2
Add
BLAST
Domaini182 – 21736EF-hand 3
Add
BLAST
Domaini219 – 25234EF-hand 4
Add
BLAST
Domaini317 – 35236EF-hand 5
Add
BLAST

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili357 – 570214 Reviewed prediction
Add
BLAST
Coiled coili625 – 1027403 Reviewed prediction
Add
BLAST
Coiled coili1068 – 109932 Reviewed prediction
Add
BLAST
Coiled coili1181 – 1341161 Reviewed prediction
Add
BLAST
Coiled coili1441 – 1816376 Reviewed prediction
Add
BLAST
Coiled coili1854 – 188532 Reviewed prediction
Add
BLAST
Coiled coili1922 – 2067146 Reviewed prediction
Add
BLAST

Domaini

The coiled coil region from Asn-1611 to Pro-1693 is necessary and sufficient for the targeting to centrosome.

Sequence similaritiesi

Contains 5 EF-hand domains.

Keywords - Domaini

Coiled coil, Repeat

Phylogenomic databases

eggNOGiNOG124644.
HOGENOMiHOG000293170.
HOVERGENiHBG052623.
KOiK16476.
OMAiAMMHDLQ.
PhylomeDBiQ8N4C6.
TreeFamiTF325139.

Family and domain databases

Gene3Di1.10.238.10. 2 hits.
InterProiIPR011992. EF-hand-dom_pair.
IPR002048. EF_hand_dom.
[Graphical view]
PfamiPF13405. EF-hand_6. 1 hit.
[Graphical view]
PROSITEiPS50222. EF_HAND_2. 5 hits.
[Graphical view]

Sequences (9)i

Sequence statusi: Complete.

This entry describes 9 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q8N4C6-1) [UniParc]FASTAAdd to Basket

Also known as: Lm

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MDEVEQDQHE ARLKELFDSF DTTGTGSLGQ EELTDLCHML SLEEVAPVLQ     50
QTLLQDNLLG RVHFDQFKEA LILILSRTLS NEEHFQEPDC SLEAQPKYVR 100
GGKRYGRRSL PEFQESVEEF PEVTVIEPLD EEARPSHIPA GDCSEHWKTQ 150
RSEEYEAEGQ LRFWNPDDLN ASQSGSSPPQ DWIEEKLQEV CEDLGITRDG 200
HLNRKKLVSI CEQYGLQNVD GEMLEEVFHN LDPDGTMSVE DFFYGLFKNG 250
KSLTPSASTP YRQLKRHLSM QSFDESGRRT TTSSAMTSTI GFRVFSCLDD 300
GMGHASVERI LDTWQEEGIE NSQEILKALD FSLDGNINLT ELTLALENEL 350
LVTKNSIHQA ALASFKAEIR HLLERVDQVV REKEKLRSDL DKAEKLKSLM 400
ASEVDDHHAA IERRNEYNLR KLDEEYKERI AALKNELRKE REQILQQAGK 450
QRLELEQEIE KAKTEENYIR DRLALSLKEN SRLENELLEN AEKLAEYENL 500
TNKLQRNLEN VLAEKFGDLD PSSAEFFLQE ERLTQMRNEY ERQCRVLQDQ 550
VDELQSELEE YRAQGRVLRL PLKNSPSEEV EANSGGIEPE HGLGSEECNP 600
LNMSIEAELV IEQMKEQHHR DICCLRLELE DKVRHYEKQL DETVVSCKKA 650
QENMKQRHEN ETHTLEKQIS DLKNEIAELQ GQAAVLKEAH HEATCRHEEE 700
KKQLQVKLEE EKTHLQEKLR LQHEMELKAR LTQAQASFER EREGLQSSAW 750
TEEKVRGLTQ ELEQFHQEQL TSLVEKHTLE KEELRKELLE KHQRELQEGR 800
EKMETECNRR TSQIEAQFQS DCQKVTERCE SALQSLEGRY RQELKDLQEQ 850
QREEKSQWEF EKDELTQECA EAQELLKETL KREKTTSLVL TQEREMLEKT 900
YKEHLNSMVV ERQQLLQDLE DLRNVSETQQ SLLSDQILEL KSSHKRELRE 950
REEVLCQAGA SEQLASQRLE RLEMEHDQER QEMMSKLLAM ENIHKATCET 1000
ADRERAEMST EISRLQSKIK EMQQATSPLS MLQSGCQVIG EEEVEGDGAL 1050
SLLQQGEQLL EENGDVLLSL QRAHEQAVKE NVKMATEISR LQQRLQKLEP 1100
GLVMSSCLDE PATEFFGNTA EQTEQFLQQN RTKQVEGVTR RHVLSDLEDD 1150
EVRDLGSTGT SSVQRQEVKI EESEASVEGF SELENSEETR TESWELKNQI 1200
SQLQEQLMML CADCDRASEK KQDLLFDVSV LKKKLKMLER IPEASPKYKL 1250
LYEDVSREND CLQEELRMME TRYDEALENN KELTAEVFRL QDELKKMEEV 1300
TETFLSLEKS YDEVKIENEG LNVLVLRLQG KIEKLQESVV QRCDCCLWEA 1350
SLENLEIEPD GNILQLNQTL EECVPRVRSV HHVIEECKQE NQYLEGNTQL 1400
LEKVKAHEIA WLHGTIQTHQ ERPRVQNQVI LEENTTLLGF QDKHFQHQAT 1450
IAELELEKTK LQELTRKLKE RVTILVKQKD VLSHGEKEEE LKAMMHDLQI 1500
TCSEMQQKVE LLRYESEKLQ QENSILRNEI TTLNEEDSIS NLKLGTLNGS 1550
QEEMWQKTET VKQENAAVQK MVENLKKQIS ELKIKNQQLD LENTELSQKN 1600
SQNQEKLQEL NQRLTEMLCQ KEKEPGNSAL EEREQEKFNL KEELERCKVQ 1650
SSTLVSSLEA ELSEVKIQTH IVQQENHLLK DELEKMKQLH RCPDLSDFQQ 1700
KISSVLSYNE KLLKEKEALS EELNSCVDKL AKSSLLEHRI ATMKQEQKSW 1750
EHQSASLKSQ LVASQEKVQN LEDTVQNVNL QMSRMKSDLR VTQQEKEALK 1800
QEVMSLHKQL QNAGGKSWAP EIATHPSGLH NQQKRLSWDK LDHLMNEEQQ 1850
LLWQENERLQ TMVQNTKAEL THSREKVRQL ESNLLPKHQK HLNPSGTMNP 1900
TEQEKLSLKR ECDQFQKEQS PANRKVSQMN SLEQELETIH LENEGLKKKQ 1950
VKLDEQLMEM QHLRSTATPS PSPHAWDLQL LQQQACPMVP REQFLQLQRQ 2000
LLQAERINQH LQEELENRTS ETNTPQGNQE QLVTVMEERM IEVEQKLKLV 2050
KRLLQEKVNQ LKEQVSLPGH LCSPTSHSSF NSSFTSLYCH 2090
Length:2,090
Mass (Da):243,249
Last modified:November 2, 2010 - v4
Checksum:i51D27CD38A369209
GO
Isoform 2 (identifier: Q8N4C6-2) [UniParc]FASTAAdd to Basket

Also known as: Isotype 3

The sequence of this isoform differs from the canonical sequence as follows:
     492-508: Missing.

Note: Dubious isoform produced through aberrant splice sites.

Show »
Length:2,073
Mass (Da):241,191
Checksum:i784E25AE5D1C68DE
GO
Isoform 3 (identifier: Q8N4C6-10) [UniParc]FASTAAdd to Basket

Also known as: Isotype 2

The sequence of this isoform differs from the canonical sequence as follows:
     492-508: Missing.
     2065-2090: VSLPGHLCSPTSHSSFNSSFTSLYCH → LCKNTKADAM...PLTSTPPLRS

Note: Dubious isoform produced through aberrant splice sites.

Show »
Length:2,116
Mass (Da):246,135
Checksum:i0A9CEF8ECA2BF346
GO
Isoform 4 (identifier: Q8N4C6-4) [UniParc]FASTAAdd to Basket

Also known as: Isotype 1

The sequence of this isoform differs from the canonical sequence as follows:
     492-508: Missing.
     2027-2046: GNQEQLVTVMEERMIEVEQK → ALLPEQRAVHADSYRRIGHL
     2047-2090: Missing.

Note: Dubious isoform produced through aberrant splice sites.

Show »
Length:2,029
Mass (Da):236,135
Checksum:iF994E939809252CB
GO
Isoform 5 (identifier: Q8N4C6-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-35: MDEVEQDQHEARLKELFDSFDTTGTGSLGQEELTD → MAEVTVPRVY...HRKIQHVKNE

Show »
Length:2,096
Mass (Da):243,889
Checksum:i32552AFD21D13A70
GO
Isoform 6 (identifier: Q8N4C6-6) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     800-1512: Missing.
     1555-1555: Missing.
     1960-1988: MQHLRSTATPSPSPHAWDLQLLQQQACPM → NSVVGSSREGCSSLPEIVCEDAAPEVHCDA
     1989-2090: Missing.

Note: No experimental confirmation available.

Show »
Length:1,275
Mass (Da):147,799
Checksum:iA34D34D74D9B861C
GO
Isoform 7 (identifier: Q8N4C6-7) [UniParc]FASTAAdd to Basket

Also known as: B

The sequence of this isoform differs from the canonical sequence as follows:
     2065-2090: VSLPGHLCSPTSHSSFNSSFTSLYCH → LCKNTKADAM...PLTSTPPLRS

Note: No experimental confirmation available.

Show »
Length:2,133
Mass (Da):248,194
Checksum:i7B4B1C5A69FD4424
GO
Isoform 8 (identifier: Q8N4C6-9) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-38: Missing.

Note: No experimental confirmation available.

Show »
Length:2,052
Mass (Da):238,941
Checksum:i77E187FF00857A7D
GO
Isoform 9 (identifier: Q8N4C6-11) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     800-1512: Missing.

Note: No experimental confirmation available.

Show »
Length:1,377
Mass (Da):160,136
Checksum:i19AE5E3800593B03
GO

Sequence cautioni

The sequence AAH65521.1 differs from that shown. Reason: Contaminating sequence. Potential poly-A sequence.
The sequence AAK00628.1 differs from that shown. Reason: Several sequencing errors.
The sequence AAK00629.1 differs from that shown. Reason: Several sequencing errors and frameshifts.
The sequence AAK00630.1 differs from that shown. Reason: Several sequencing errors.
The sequence AAH65521.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.
The sequence BAB13391.2 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.
The sequence BAB15640.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti1111 – 11111P → A.
Corresponds to variant rs2236316 [ dbSNP | Ensembl ].
VAR_019453
Natural varianti1125 – 11251Q → P.3 Publications
Corresponds to variant rs12882191 [ dbSNP | Ensembl ].
VAR_051235
Natural varianti1222 – 12221Q → R in SCKL7; does not disrupt protein expression or localization or affect mitotic functions in an obvious way. 1 Publication
Corresponds to variant rs187464517 [ dbSNP | Ensembl ].
VAR_069083
Natural varianti1320 – 13201G → E.4 Publications
Corresponds to variant rs2073347 [ dbSNP | Ensembl ].
VAR_019454
Natural varianti1709 – 17091N → S in SCKL7; does not disrupt protein expression or localization or affect mitotic functions in an obvious way. 1 Publication
VAR_069084
Natural varianti1837 – 18371S → T.
Corresponds to variant rs12717411 [ dbSNP | Ensembl ].
VAR_019455
Natural varianti1934 – 19341Q → E.
Corresponds to variant rs2295847 [ dbSNP | Ensembl ].
VAR_051236

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 3838Missing in isoform 8.
VSP_040039Add
BLAST
Alternative sequencei1 – 3535MDEVE…EELTD → MAEVTVPRVYVVFGIHCIMA KASSDVQVSGFHRKIQHVKN E in isoform 5.
VSP_010950Add
BLAST
Alternative sequencei492 – 50817Missing in isoform 2, isoform 3 and isoform 4.
VSP_010952Add
BLAST
Alternative sequencei800 – 1512713Missing in isoform 6 and isoform 9.
VSP_010953Add
BLAST
Alternative sequencei1555 – 15551Missing in isoform 6.
VSP_010954
Alternative sequencei1960 – 198829MQHLR…QACPM → NSVVGSSREGCSSLPEIVCE DAAPEVHCDA in isoform 6.
VSP_010955Add
BLAST
Alternative sequencei1989 – 2090102Missing in isoform 6.
VSP_010956Add
BLAST
Alternative sequencei2027 – 204620GNQEQ…EVEQK → ALLPEQRAVHADSYRRIGHL in isoform 4.
VSP_010957Add
BLAST
Alternative sequencei2047 – 209044Missing in isoform 4.
VSP_010958Add
BLAST
Alternative sequencei2065 – 209026VSLPG…SLYCH → LCKNTKADAMVKDLYVENAQ LLKALEVTEQRQKTAEKKNY LLEEKIASLSNIVRNLTPAP LTSTPPLRS in isoform 3 and isoform 7.
VSP_010960Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti137 – 1371H → Y in AAF23015. 1 Publication
Sequence conflicti137 – 1371H → Y in AAG33512. 1 Publication
Sequence conflicti177 – 1771S → F in AAF23015. 1 Publication
Sequence conflicti203 – 2031N → D in AAG33512. 1 Publication
Sequence conflicti223 – 2231M → I in AAG33512. 1 Publication
Sequence conflicti295 – 2951F → I in AAG33512. 1 Publication
Sequence conflicti369 – 3691I → V in AAG33512. 1 Publication
Sequence conflicti399 – 3991L → S in AAG33512. 1 Publication
Sequence conflicti568 – 5681L → F in AAG33512. 1 Publication
Sequence conflicti809 – 8091R → I in AAF23015. 1 Publication
Sequence conflicti812 – 8121S → T in AAG33512. 1 Publication
Sequence conflicti945 – 9451K → I in AAG33512. 1 Publication
Sequence conflicti977 – 9771D → A in AAG33512. 1 Publication
Sequence conflicti980 – 9801R → G in AAF23015. 1 Publication
Sequence conflicti1054 – 10541Q → H in AAG33512. 1 Publication
Sequence conflicti1067 – 10671L → F in AAG33512. 1 Publication
Sequence conflicti1070 – 10701L → Q in AAF23015. 1 Publication
Sequence conflicti1150 – 11501D → G in AAF23015. 1 Publication
Sequence conflicti1237 – 12371M → I in AAF23015. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF212162 mRNA. Translation: AAF23015.2.
AF302773 mRNA. Translation: AAG33512.2.
AF223937 mRNA. Translation: AAK00628.1. Sequence problems.
AF223938 mRNA. Translation: AAK00629.1. Sequence problems.
AF223939 mRNA. Translation: AAK00630.1. Sequence problems.
AB046785 mRNA. Translation: BAB13391.2. Different initiation.
AL133485 Genomic DNA. No translation available.
AL606834 Genomic DNA. No translation available.
BC034708 mRNA. Translation: AAH34708.2.
BC065521 mRNA. Translation: AAH65521.1. Sequence problems.
BC090932 mRNA. Translation: AAH90932.1.
AY027794 mRNA. Translation: AAK27375.1.
AY027795 mRNA. Translation: AAK27376.1.
AY027796 mRNA. Translation: AAK27377.1.
AF186776 mRNA. Translation: AAG17027.1.
AK027054 mRNA. Translation: BAB15640.1. Different initiation.
CCDSiCCDS32078.2. [Q8N4C6-11]
CCDS32079.1. [Q8N4C6-1]
RefSeqiNP_057434.4. NM_016350.4. [Q8N4C6-11]
NP_065972.3. NM_020921.3.
NP_891989.2. NM_182944.2.
NP_891991.1. NM_182946.1.
UniGeneiHs.310429.
Hs.569387.

Genome annotation databases

EnsembliENST00000245441; ENSP00000245441; ENSG00000100503. [Q8N4C6-7]
ENST00000382041; ENSP00000371472; ENSG00000100503. [Q8N4C6-1]
ENST00000382043; ENSP00000371474; ENSG00000100503. [Q8N4C6-11]
ENST00000530997; ENSP00000436092; ENSG00000100503. [Q8N4C6-7]
GeneIDi51199.
KEGGihsa:51199.
UCSCiuc001wyi.3. human. [Q8N4C6-7]
uc001wyk.3. human. [Q8N4C6-11]
uc001wym.2. human. [Q8N4C6-1]

Polymorphism databases

DMDMi311033487.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF212162 mRNA. Translation: AAF23015.2 .
AF302773 mRNA. Translation: AAG33512.2 .
AF223937 mRNA. Translation: AAK00628.1 . Sequence problems.
AF223938 mRNA. Translation: AAK00629.1 . Sequence problems.
AF223939 mRNA. Translation: AAK00630.1 . Sequence problems.
AB046785 mRNA. Translation: BAB13391.2 . Different initiation.
AL133485 Genomic DNA. No translation available.
AL606834 Genomic DNA. No translation available.
BC034708 mRNA. Translation: AAH34708.2 .
BC065521 mRNA. Translation: AAH65521.1 . Sequence problems.
BC090932 mRNA. Translation: AAH90932.1 .
AY027794 mRNA. Translation: AAK27375.1 .
AY027795 mRNA. Translation: AAK27376.1 .
AY027796 mRNA. Translation: AAK27377.1 .
AF186776 mRNA. Translation: AAG17027.1 .
AK027054 mRNA. Translation: BAB15640.1 . Different initiation.
CCDSi CCDS32078.2. [Q8N4C6-11 ]
CCDS32079.1. [Q8N4C6-1 ]
RefSeqi NP_057434.4. NM_016350.4. [Q8N4C6-11 ]
NP_065972.3. NM_020921.3.
NP_891989.2. NM_182944.2.
NP_891991.1. NM_182946.1.
UniGenei Hs.310429.
Hs.569387.

3D structure databases

ProteinModelPortali Q8N4C6.
ModBasei Search...

Protein-protein interaction databases

BioGridi 119372. 8 interactions.
IntActi Q8N4C6. 6 interactions.
MINTi MINT-1175275.

Chemistry

BindingDBi Q8N4C6.

PTM databases

PhosphoSitei Q8N4C6.

Polymorphism databases

DMDMi 311033487.

Proteomic databases

MaxQBi Q8N4C6.
PaxDbi Q8N4C6.
PRIDEi Q8N4C6.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000245441 ; ENSP00000245441 ; ENSG00000100503 . [Q8N4C6-7 ]
ENST00000382041 ; ENSP00000371472 ; ENSG00000100503 . [Q8N4C6-1 ]
ENST00000382043 ; ENSP00000371474 ; ENSG00000100503 . [Q8N4C6-11 ]
ENST00000530997 ; ENSP00000436092 ; ENSG00000100503 . [Q8N4C6-7 ]
GeneIDi 51199.
KEGGi hsa:51199.
UCSCi uc001wyi.3. human. [Q8N4C6-7 ]
uc001wyk.3. human. [Q8N4C6-11 ]
uc001wym.2. human. [Q8N4C6-1 ]

Organism-specific databases

CTDi 51199.
GeneCardsi GC14M051187.
GeneReviewsi NIN.
HGNCi HGNC:14906. NIN.
HPAi HPA005939.
MIMi 608684. gene.
614851. phenotype.
neXtProti NX_Q8N4C6.
Orphaneti 319675. Microcephalic primordial dwarfism, Dauber type.
PharmGKBi PA31630.
HUGEi Search...
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG124644.
HOGENOMi HOG000293170.
HOVERGENi HBG052623.
KOi K16476.
OMAi AMMHDLQ.
PhylomeDBi Q8N4C6.
TreeFami TF325139.

Miscellaneous databases

ChiTaRSi NIN. human.
GeneWikii NIN_(gene).
GenomeRNAii 51199.
NextBioi 54220.
PROi Q8N4C6.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q8N4C6.
Bgeei Q8N4C6.
Genevestigatori Q8N4C6.

Family and domain databases

Gene3Di 1.10.238.10. 2 hits.
InterProi IPR011992. EF-hand-dom_pair.
IPR002048. EF_hand_dom.
[Graphical view ]
Pfami PF13405. EF-hand_6. 1 hit.
[Graphical view ]
PROSITEi PS50222. EF_HAND_2. 5 hits.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Cloning and characterization of a novel human ninein protein that interacts with the glycogen synthase kinase 3beta."
    Hong Y.-R., Chen C.-H., Chang J.-H., Wang S.-K., Sy W.-D., Chou C.-K., Howng S.-L.
    Biochim. Biophys. Acta 1492:513-516(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 5), SUBCELLULAR LOCATION, TISSUE SPECIFICITY, INTERACTION WITH GSK3B, VARIANTS PRO-1125 AND GLU-1320.
    Tissue: Fetal liver.
  2. "Genomic organization and molecular characterization of the human ninein gene."
    Hong Y.-R., Chen C.-H., Chuo M.-H., Liou S.-Y., Howng S.-L.
    Biochem. Biophys. Res. Commun. 279:989-995(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY, VARIANTS PRO-1125 AND GLU-1320.
  3. "Human ninein is a centrosomal autoantigen recognized by CREST patient sera and plays a regulatory role in microtubule nucleation."
    Stillwell E.E., Zhou J., Joshi H.C.
    Cell Cycle 3:923-930(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2 AND 4), PARTIAL NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), FUNCTION, ALTERNATIVE SPLICING, SUBCELLULAR LOCATION, VARIANTS PRO-1125 AND GLU-1320.
    Tissue: Thymus.
  4. "Prediction of the coding sequences of unidentified human genes. XVIII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."
    Nagase T., Kikuno R., Nakayama M., Hirosawa M., Ohara O.
    DNA Res. 7:273-281(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 6).
    Tissue: Brain.
  5. "Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones."
    Nakajima D., Okazaki N., Yamakawa H., Kikuno R., Ohara O., Nagase T.
    DNA Res. 9:99-106(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: SEQUENCE REVISION.
  6. "The DNA sequence and analysis of human chromosome 14."
    Heilig R., Eckenberg R., Petit J.-L., Fonknechten N., Da Silva C., Cattolico L., Levy M., Barbe V., De Berardinis V., Ureta-Vidal A., Pelletier E., Vico V., Anthouard V., Rowen L., Madan A., Qin S., Sun H., Du H.
    , Pepin K., Artiguenave F., Robert C., Cruaud C., Bruels T., Jaillon O., Friedlander L., Samson G., Brottier P., Cure S., Segurens B., Aniere F., Samain S., Crespeau H., Abbasi N., Aiach N., Boscus D., Dickhoff R., Dors M., Dubois I., Friedman C., Gouyvenoux M., James R., Madan A., Mairey-Estrada B., Mangenot S., Martins N., Menard M., Oztas S., Ratcliffe A., Shaffer T., Trask B., Vacherie B., Bellemere C., Belser C., Besnard-Gonnet M., Bartol-Mavel D., Boutard M., Briez-Silla S., Combette S., Dufosse-Laurent V., Ferron C., Lechaplais C., Louesse C., Muselet D., Magdelenat G., Pateau E., Petit E., Sirvain-Trukniewicz P., Trybou A., Vega-Czarny N., Bataille E., Bluet E., Bordelais I., Dubois M., Dumont C., Guerin T., Haffray S., Hammadi R., Muanga J., Pellouin V., Robert D., Wunderle E., Gauguet G., Roy A., Sainte-Marthe L., Verdier J., Verdier-Discala C., Hillier L.W., Fulton L., McPherson J., Matsuda F., Wilson R., Scarpelli C., Gyapay G., Wincker P., Saurin W., Quetier F., Waterston R., Hood L., Weissenbach J.
    Nature 421:601-607(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  7. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 9), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-434 (ISOFORM 8), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1877-2090 (ISOFORM 4).
    Tissue: Lymph.
  8. "3' isoforms of human ninein."
    Choquette M.C., de Medicis E.
    Submitted (FEB-2001) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1561-2090 (ISOFORMS 1 AND 7).
    Tissue: Bone marrow.
  9. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1928-2090 (ISOFORM 7).
    Tissue: Hepatoma.
  10. "CEP110 and ninein are located in a specific domain of the centrosome associated with centrosome maturation."
    Ou Y.Y., Mack G.J., Zhang M., Rattner J.B.
    J. Cell Sci. 115:1825-1835(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: SUBCELLULAR LOCATION.
  11. "Assembly of centrosomal proteins and microtubule organization depends on PCM-1."
    Dammermann A., Merdes A.
    J. Cell Biol. 159:255-266(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: SUBCELLULAR LOCATION.
  12. "Molecular characterization of human ninein protein: two distinct subdomains required for centrosomal targeting and regulating signals in cell cycle."
    Chen C.-H., Howng S.-L., Cheng T.-S., Chou M.-H., Huang C.-Y., Hong Y.-R.
    Biochem. Biophys. Res. Commun. 308:975-983(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: HOMOOLIGOMERIZATION, SUBCELLULAR LOCATION, DEVELOPMENTAL STAGE, PHOSPHORYLATION.
  13. "A novel ninein-interaction protein, CGI-99, blocks ninein phosphorylation by GSK3beta and is highly expressed in brain tumors."
    Howng S.-L., Hsu H.-C., Cheng T.-S., Lee Y.-L., Chang L.-K., Lu P.-J., Hong Y.-R.
    FEBS Lett. 566:162-168(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH C14ORF166.
  14. "Autoantibodies to a group of centrosomal proteins in human autoimmune sera reactive with the centrosome."
    Mack G.J., Rees J., Sandblom O., Balczon R., Fritzler M.J., Rattner J.B.
    Arthritis Rheum. 41:551-558(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: AUTOANTIBODY.
  15. "Spectrum of centrosome autoantibodies in childhood varicella and post-varicella acute cerebellar ataxia."
    Fritzler M.J., Zhang M., Stinton L.M., Rattner J.B.
    BMC Pediatr. 3:11-11(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: AUTOANTIBODY.
  16. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1550, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Embryonic kidney.
  17. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
    Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
    Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1550, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Leukemic T-cell.
  18. "Functional characterization of AIBp, a novel Aurora-A binding protein in centrosome structure and spindle formation."
    Lieu A.S., Cheng T.S., Chou C.H., Wu C.H., Hsu C.Y., Huang C.Y., Chang L.K., Loh J.K., Chang C.S., Hsu C.M., Howng S.L., Hong Y.R.
    Int. J. Oncol. 37:429-436(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH AUNIP.
  19. Cited for: VARIANT [LARGE SCALE ANALYSIS] GLU-1320.
  20. Cited for: VARIANTS SCKL7 ARG-1222 AND SER-1709.

Entry informationi

Entry nameiNIN_HUMAN
AccessioniPrimary (citable) accession number: Q8N4C6
Secondary accession number(s): A6NDB8
, B7WPA3, C9JSB6, C9JSG2, C9JXL2, Q5BKU3, Q6P0P6, Q9BWU6, Q9C012, Q9C013, Q9C014, Q9H5I6, Q9HAT7, Q9HBY5, Q9HCK7, Q9UH61
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 19, 2004
Last sequence update: November 2, 2010
Last modified: July 9, 2014
This is version 115 of the entry and version 4 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Miscellaneous

Antibodies against NIN are present in sera from patients with autoimmune diseases that developed autoantibodies against centrosomal proteins.

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 14
    Human chromosome 14: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi