Q8N4C6 (NIN_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 101.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Ninein Short name=hNinein Alternative name(s): Glycogen synthase kinase 3 beta-interacting protein Short name=GSK3B-interacting protein | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 2090 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Centrosomal protein required in the positioning and anchorage of the microtubule minus-end in epithelial cells. May also act as a centrosome maturation factor. May play a role in microtubule nucleation. Overexpression does not perturb nucleation or elongation of microtubules but suppresses release of microtubules. Ref.3 |
| Subunit structure | Homooligomer. Interacts with GSK3B/GSK3-beta via its C-terminus domain. Interacts with C14ORF166, such interaction may prevent its phosphorylation by GSK3B. Interacts with AUNIP (via N-terminus). Identified in a complex with AUNIP and AURKA. Ref.1 Ref.12 Ref.13 Ref.18 |
| Subcellular location | Cytoplasm › cytoskeleton › centrosome. Note: Component of the core centrosome. Arranged in a tubular conformation with an open and a closed end within the centrosome. In the mother centrosome, it localizes at both ends of the centrosome tube, including the site of centrosome duplication, while in the daughter centrosome it is present only at the closed end. Requires PCM1 for centrosome localization. Ref.1 Ref.3 Ref.10 Ref.11 Ref.12 |
| Tissue specificity | Ubiquitous. Highly expressed in heart and skeletal muscle. Isoform 1 is more expressed than isoform 5. Ref.1 Ref.2 |
| Developmental stage | In interphase cells, it is localized in the centrosome. Decreases in metaphase and anaphase and reappears in telophase. Ref.12 |
| Domain | The coiled coil region from Asn-1611 to Pro-1693 is necessary and sufficient for the targeting to centrosome. |
| Post-translational modification | Phosphorylated by AURKA/Aurora kinase A and PKA kinases but not CK2 or AURKB/ Aurora kinase B. Ref.12 |
| Involvement in disease | Seckel syndrome 7 (SCKL7) [MIM:614851]: A rare autosomal recessive disorder characterized by proportionate dwarfism of prenatal onset associated with low birth weight, growth retardation, severe microcephaly with a bird-headed like appearance, and mental retardation. |
| Miscellaneous | Antibodies against NIN are present in sera from patients with autoimmune diseases that developed autoantibodies against centrosomal proteins. |
| Sequence similarities | Contains 5 EF-hand domains. |
| Sequence caution | The sequence AAH65521.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened. The sequence AAH65521.1 differs from that shown. Reason: Contaminating sequence. Potential poly-A sequence. The sequence AAK00628.1 differs from that shown. Reason: Several sequencing errors. The sequence AAK00629.1 differs from that shown. Reason: Several sequencing errors and frameshifts. The sequence AAK00630.1 differs from that shown. Reason: Several sequencing errors. The sequence BAB13391.2 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened. The sequence BAB15640.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cytoplasm Cytoskeleton Microtubule |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Disease | Disease mutation Dwarfism Mental retardation |
| Domain | Coiled coil Repeat |
| Ligand | GTP-binding Nucleotide-binding |
| PTM | Phosphoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | centrosome localization Traceable author statement PubMed 16154161. Source: HGNC centrosome-templated microtubule nucleationInferred from electronic annotation. Source: Compara microtubule anchoring at centrosomeInferred from electronic annotation. Source: Compara |
| Cellular_component | centriole Inferred from electronic annotation. Source: Compara centrosomeInferred from direct assay PubMed 21399614. Source: UniProtKB microtubuleInferred from electronic annotation. Source: UniProtKB-KW |
| Molecular_function | GTP binding Inferred from electronic annotation. Source: UniProtKB-KW calcium ion bindingInferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| C14orf166 | Q9Y224 | 4 | EBI-1164022,EBI-1104547 | |
| GSK3B | P49841 | 2 | EBI-1164022,EBI-373586 |
Alternative products
| This entry describes 9 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q8N4C6-1) Also known as: Lm; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q8N4C6-2) Also known as: Isotype 3; The sequence of this isoform differs from the canonical sequence as follows: 492-508: Missing. | ||||||
| Note: Dubious isoform produced through aberrant splice sites. | ||||||
| Isoform 3 (identifier: Q8N4C6-10) Also known as: Isotype 2; The sequence of this isoform differs from the canonical sequence as follows: 492-508: Missing. 2065-2090: VSLPGHLCSPTSHSSFNSSFTSLYCH → LCKNTKADAM...PLTSTPPLRS | ||||||
| Note: Dubious isoform produced through aberrant splice sites. | ||||||
| Isoform 4 (identifier: Q8N4C6-4) Also known as: Isotype 1; The sequence of this isoform differs from the canonical sequence as follows: 492-508: Missing. 2027-2046: GNQEQLVTVMEERMIEVEQK → ALLPEQRAVHADSYRRIGHL 2047-2090: Missing. | ||||||
| Note: Dubious isoform produced through aberrant splice sites. | ||||||
| Isoform 5 (identifier: Q8N4C6-5) The sequence of this isoform differs from the canonical sequence as follows: 1-35: MDEVEQDQHEARLKELFDSFDTTGTGSLGQEELTD → MAEVTVPRVY...HRKIQHVKNE | ||||||
| Isoform 6 (identifier: Q8N4C6-6) The sequence of this isoform differs from the canonical sequence as follows: 800-1512: Missing. 1555-1555: Missing. 1960-1988: MQHLRSTATPSPSPHAWDLQLLQQQACPM → NSVVGSSREGCSSLPEIVCEDAAPEVHCDA 1989-2090: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 7 (identifier: Q8N4C6-7) Also known as: B; The sequence of this isoform differs from the canonical sequence as follows: 2065-2090: VSLPGHLCSPTSHSSFNSSFTSLYCH → LCKNTKADAM...PLTSTPPLRS | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 8 (identifier: Q8N4C6-9) The sequence of this isoform differs from the canonical sequence as follows: 1-38: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 9 (identifier: Q8N4C6-11) The sequence of this isoform differs from the canonical sequence as follows: 800-1512: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 2090 | 2090 | Ninein | PRO_0000096844 | |||||
Regions | |||||||||
| Domain | 8 – 43 | 36 | EF-hand 1 | ||||||
| Domain | 42 – 77 | 36 | EF-hand 2 | ||||||
| Domain | 182 – 217 | 36 | EF-hand 3 | ||||||
| Domain | 219 – 252 | 34 | EF-hand 4 | ||||||
| Domain | 317 – 352 | 36 | EF-hand 5 | ||||||
| Nucleotide binding | 245 – 252 | 8 | GTP Potential | ||||||
| Nucleotide binding | 300 – 304 | 5 | GTP Potential | ||||||
| Nucleotide binding | 420 – 423 | 4 | GTP Potential | ||||||
| Coiled coil | 357 – 570 | 214 | Potential | ||||||
| Coiled coil | 625 – 1027 | 403 | Potential | ||||||
| Coiled coil | 1068 – 1099 | 32 | Potential | ||||||
| Coiled coil | 1181 – 1341 | 161 | Potential | ||||||
| Coiled coil | 1441 – 1816 | 376 | Potential | ||||||
| Coiled coil | 1854 – 1885 | 32 | Potential | ||||||
| Coiled coil | 1922 – 2067 | 146 | Potential | ||||||
Amino acid modifications | |||||||||
| Modified residue | 1550 | 1 | Phosphoserine Ref.16 Ref.17 | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 38 | 38 | Missing in isoform 8. | VSP_040039 | |||||
| Alternative sequence | 1 – 35 | 35 | MDEVE…EELTD → MAEVTVPRVYVVFGIHCIMA KASSDVQVSGFHRKIQHVKN E in isoform 5. | VSP_010950 | |||||
| Alternative sequence | 492 – 508 | 17 | Missing in isoform 2, isoform 3 and isoform 4. | VSP_010952 | |||||
| Alternative sequence | 800 – 1512 | 713 | Missing in isoform 6 and isoform 9. | VSP_010953 | |||||
| Alternative sequence | 1555 | 1 | Missing in isoform 6. | VSP_010954 | |||||
| Alternative sequence | 1960 – 1988 | 29 | MQHLR…QACPM → NSVVGSSREGCSSLPEIVCE DAAPEVHCDA in isoform 6. | VSP_010955 | |||||
| Alternative sequence | 1989 – 2090 | 102 | Missing in isoform 6. | VSP_010956 | |||||
| Alternative sequence | 2027 – 2046 | 20 | GNQEQ…EVEQK → ALLPEQRAVHADSYRRIGHL in isoform 4. | VSP_010957 | |||||
| Alternative sequence | 2047 – 2090 | 44 | Missing in isoform 4. | VSP_010958 | |||||
| Alternative sequence | 2065 – 2090 | 26 | VSLPG…SLYCH → LCKNTKADAMVKDLYVENAQ LLKALEVTEQRQKTAEKKNY LLEEKIASLSNIVRNLTPAP LTSTPPLRS in isoform 3 and isoform 7. | VSP_010960 | |||||
| Natural variant | 1111 | 1 | P → A. Corresponds to variant rs2236316 [ dbSNP | Ensembl ]. | VAR_019453 | |||||
| Natural variant | 1125 | 1 | Q → P. Ref.1 Ref.2 Ref.3 Corresponds to variant rs12882191 [ dbSNP | Ensembl ]. | VAR_051235 | |||||
| Natural variant | 1222 | 1 | Q → R in SCKL7; does not disrupt protein expression or localization or affect mitotic functions in an obvious way. Ref.20 | VAR_069083 | |||||
| Natural variant | 1320 | 1 | G → E. Ref.1 Ref.2 Ref.3 Ref.19 Corresponds to variant rs2073347 [ dbSNP | Ensembl ]. | VAR_019454 | |||||
| Natural variant | 1709 | 1 | N → S in SCKL7; does not disrupt protein expression or localization or affect mitotic functions in an obvious way. Ref.20 | VAR_069084 | |||||
| Natural variant | 1837 | 1 | S → T. Corresponds to variant rs12717411 [ dbSNP | Ensembl ]. | VAR_019455 | |||||
| Natural variant | 1934 | 1 | Q → E. Corresponds to variant rs2295847 [ dbSNP | Ensembl ]. | VAR_051236 | |||||
Experimental info | |||||||||
| Sequence conflict | 137 | 1 | H → Y in AAF23015. Ref.1 | ||||||
| Sequence conflict | 137 | 1 | H → Y in AAG33512. Ref.2 | ||||||
| Sequence conflict | 177 | 1 | S → F in AAF23015. Ref.1 | ||||||
| Sequence conflict | 203 | 1 | N → D in AAG33512. Ref.2 | ||||||
| Sequence conflict | 223 | 1 | M → I in AAG33512. Ref.2 | ||||||
| Sequence conflict | 295 | 1 | F → I in AAG33512. Ref.2 | ||||||
| Sequence conflict | 369 | 1 | I → V in AAG33512. Ref.2 | ||||||
| Sequence conflict | 399 | 1 | L → S in AAG33512. Ref.2 | ||||||
| Sequence conflict | 568 | 1 | L → F in AAG33512. Ref.2 | ||||||
| Sequence conflict | 809 | 1 | R → I in AAF23015. Ref.1 | ||||||
| Sequence conflict | 812 | 1 | S → T in AAG33512. Ref.2 | ||||||
| Sequence conflict | 945 | 1 | K → I in AAG33512. Ref.2 | ||||||
| Sequence conflict | 977 | 1 | D → A in AAG33512. Ref.2 | ||||||
| Sequence conflict | 980 | 1 | R → G in AAF23015. Ref.1 | ||||||
| Sequence conflict | 1054 | 1 | Q → H in AAG33512. Ref.2 | ||||||
| Sequence conflict | 1067 | 1 | L → F in AAG33512. Ref.2 | ||||||
| Sequence conflict | 1070 | 1 | L → Q in AAF23015. Ref.1 | ||||||
| Sequence conflict | 1150 | 1 | D → G in AAF23015. Ref.1 | ||||||
| Sequence conflict | 1237 | 1 | M → I in AAF23015. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Cloning and characterization of a novel human ninein protein that interacts with the glycogen synthase kinase 3beta." Hong Y.-R., Chen C.-H., Chang J.-H., Wang S.-K., Sy W.-D., Chou C.-K., Howng S.-L. Biochim. Biophys. Acta 1492:513-516(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 5), SUBCELLULAR LOCATION, TISSUE SPECIFICITY, INTERACTION WITH GSK3B, VARIANTS PRO-1125 AND GLU-1320. Tissue: Fetal liver. |
| [2] | "Genomic organization and molecular characterization of the human ninein gene." Hong Y.-R., Chen C.-H., Chuo M.-H., Liou S.-Y., Howng S.-L. Biochem. Biophys. Res. Commun. 279:989-995(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY, VARIANTS PRO-1125 AND GLU-1320. |
| [3] | "Human ninein is a centrosomal autoantigen recognized by CREST patient sera and plays a regulatory role in microtubule nucleation." Stillwell E.E., Zhou J., Joshi H.C. Cell Cycle 3:923-930(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2 AND 4), PARTIAL NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), FUNCTION, ALTERNATIVE SPLICING, SUBCELLULAR LOCATION, VARIANTS PRO-1125 AND GLU-1320. Tissue: Thymus. |
| [4] | "Prediction of the coding sequences of unidentified human genes. XVIII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro." Nagase T., Kikuno R., Nakayama M., Hirosawa M., Ohara O. DNA Res. 7:273-281(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 6). Tissue: Brain. |
| [5] | "Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones." Nakajima D., Okazaki N., Yamakawa H., Kikuno R., Ohara O., Nagase T. DNA Res. 9:99-106(2002) [PubMed] [Europe PMC] [Abstract] Cited for: SEQUENCE REVISION. |
| [6] | "The DNA sequence and analysis of human chromosome 14." Heilig R., Eckenberg R., Petit J.-L., Fonknechten N., Da Silva C., Cattolico L., Levy M., Barbe V., De Berardinis V., Ureta-Vidal A., Pelletier E., Vico V., Anthouard V., Rowen L., Madan A., Qin S., Sun H., Du H. Weissenbach J.Nature 421:601-607(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [7] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 9), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-434 (ISOFORM 8), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1877-2090 (ISOFORM 4). Tissue: Lymph. |
| [8] | "3' isoforms of human ninein." Choquette M.C., de Medicis E. Submitted (FEB-2001) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1561-2090 (ISOFORMS 1 AND 7). Tissue: Bone marrow. |
| [9] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1928-2090 (ISOFORM 7). Tissue: Hepatoma. |
| [10] | "CEP110 and ninein are located in a specific domain of the centrosome associated with centrosome maturation." Ou Y.Y., Mack G.J., Zhang M., Rattner J.B. J. Cell Sci. 115:1825-1835(2002) [PubMed] [Europe PMC] [Abstract] Cited for: SUBCELLULAR LOCATION. |
| [11] | "Assembly of centrosomal proteins and microtubule organization depends on PCM-1." Dammermann A., Merdes A. J. Cell Biol. 159:255-266(2002) [PubMed] [Europe PMC] [Abstract] Cited for: SUBCELLULAR LOCATION. |
| [12] | "Molecular characterization of human ninein protein: two distinct subdomains required for centrosomal targeting and regulating signals in cell cycle." Chen C.-H., Howng S.-L., Cheng T.-S., Chou M.-H., Huang C.-Y., Hong Y.-R. Biochem. Biophys. Res. Commun. 308:975-983(2003) [PubMed] [Europe PMC] [Abstract] Cited for: HOMOOLIGOMERIZATION, SUBCELLULAR LOCATION, DEVELOPMENTAL STAGE, PHOSPHORYLATION. |
| [13] | "A novel ninein-interaction protein, CGI-99, blocks ninein phosphorylation by GSK3beta and is highly expressed in brain tumors." Howng S.-L., Hsu H.-C., Cheng T.-S., Lee Y.-L., Chang L.-K., Lu P.-J., Hong Y.-R. FEBS Lett. 566:162-168(2004) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH C14ORF166. |
| [14] | "Autoantibodies to a group of centrosomal proteins in human autoimmune sera reactive with the centrosome." Mack G.J., Rees J., Sandblom O., Balczon R., Fritzler M.J., Rattner J.B. Arthritis Rheum. 41:551-558(1998) [PubMed] [Europe PMC] [Abstract] Cited for: AUTOANTIBODY. |
| [15] | "Spectrum of centrosome autoantibodies in childhood varicella and post-varicella acute cerebellar ataxia." Fritzler M.J., Zhang M., Stinton L.M., Rattner J.B. BMC Pediatr. 3:11-11(2003) [PubMed] [Europe PMC] [Abstract] Cited for: AUTOANTIBODY. |
| [16] | "ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage." Matsuoka S., Ballif B.A., Smogorzewska A., McDonald E.R. III, Hurov K.E., Luo J., Bakalarski C.E., Zhao Z., Solimini N., Lerenthal Y., Shiloh Y., Gygi S.P., Elledge S.J. Science 316:1160-1166(2007) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1550, MASS SPECTROMETRY. Tissue: Embryonic kidney. |
| [17] | "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions." Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K. Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1550, MASS SPECTROMETRY. Tissue: Leukemic T-cell. |
| [18] | "Functional characterization of AIBp, a novel Aurora-A binding protein in centrosome structure and spindle formation." Lieu A.S., Cheng T.S., Chou C.H., Wu C.H., Hsu C.Y., Huang C.Y., Chang L.K., Loh J.K., Chang C.S., Hsu C.M., Howng S.L., Hong Y.R. Int. J. Oncol. 37:429-436(2010) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH AUNIP. |
| [19] | "DNA sequencing of a cytogenetically normal acute myeloid leukaemia genome." Ley T.J., Mardis E.R., Ding L., Fulton B., McLellan M.D., Chen K., Dooling D., Dunford-Shore B.H., McGrath S., Hickenbotham M., Cook L., Abbott R., Larson D.E., Koboldt D.C., Pohl C., Smith S., Hawkins A., Abbott S. Wilson R.K.Nature 456:66-72(2008) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT [LARGE SCALE ANALYSIS] GLU-1320. |
| [20] | "Novel microcephalic primordial dwarfism disorder associated with variants in the centrosomal protein ninein." Dauber A., Lafranchi S.H., Maliga Z., Lui J.C., Moon J.E., McDeed C., Henke K., Zonana J., Kingman G.A., Pers T.H., Baron J., Rosenfeld R.G., Hirschhorn J.N., Harris M.P., Hwa V. J. Clin. Endocrinol. Metab. 97:E2140-E2151(2012) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS SCKL7 ARG-1222 AND SER-1709. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF212162 mRNA. Translation: AAF23015.2. AF302773 mRNA. Translation: AAG33512.2. AF223937 mRNA. Translation: AAK00628.1. Sequence problems. AF223938 mRNA. Translation: AAK00629.1. Sequence problems. AF223939 mRNA. Translation: AAK00630.1. Sequence problems. AB046785 mRNA. Translation: BAB13391.2. Different initiation. AL133485 Genomic DNA. No translation available. AL606834 Genomic DNA. No translation available. BC034708 mRNA. Translation: AAH34708.2. BC065521 mRNA. Translation: AAH65521.1. Sequence problems. BC090932 mRNA. Translation: AAH90932.1. AY027794 mRNA. Translation: AAK27375.1. AY027795 mRNA. Translation: AAK27376.1. AY027796 mRNA. Translation: AAK27377.1. AF186776 mRNA. Translation: AAG17027.1. AK027054 mRNA. Translation: BAB15640.1. Different initiation. |
| IPI | IPI00171791. IPI00329695. IPI00441952. IPI00441955. IPI00441959. IPI00883941. IPI00921003. IPI00971005. |
| RefSeq | NP_057434.4. NM_016350.4. NP_065972.3. NM_020921.3. NP_891989.2. NM_182944.2. NP_891991.1. NM_182946.1. |
| UniGene | Hs.310429. Hs.569387. |
3D structure databases | |
| ProteinModelPortal | Q8N4C6. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q8N4C6. 3 interactions. |
| MINT | MINT-1175275. |
PTM databases | |
| PhosphoSite | Q8N4C6. |
Polymorphism databases | |
| DMDM | 311033487. |
Proteomic databases | |
| PaxDb | Q8N4C6. |
| PRIDE | Q8N4C6. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000245441; ENSP00000245441; ENSG00000100503. ENST00000382041; ENSP00000371472; ENSG00000100503. ENST00000382043; ENSP00000371474; ENSG00000100503. |
| GeneID | 51199. |
| KEGG | hsa:51199. |
| UCSC | uc001wyi.3. human. uc001wym.2. human. |
Organism-specific databases | |
| CTD | 51199. |
| GeneCards | GC14M051187. |
| HGNC | HGNC:14906. NIN. |
| HPA | HPA005939. |
| MIM | 608684. gene. 614851. phenotype. |
| neXtProt | NX_Q8N4C6. |
| PharmGKB | PA31630. |
| HUGE | Search... |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG124644. |
| HOGENOM | HOG000293170. |
| HOVERGEN | HBG052623. |
| KO | K16476. |
| OMA | AMMHDLQ. |
| OrthoDB | EOG45QHC9. |
Gene expression databases | |
| ArrayExpress | Q8N4C6. |
| Bgee | Q8N4C6. |
| Genevestigator | Q8N4C6. |
| GermOnline | ENSG00000100503. Homo sapiens. |
Family and domain databases | |
| Gene3D | 1.10.238.10. 2 hits. |
| InterPro | IPR011992. EF-hand-like_dom. IPR002048. EF_hand_dom. [Graphical view] |
| PROSITE | PS50222. EF_HAND_2. 5 hits. [Graphical view] |
| ProtoNet | Search... |
Other | |
| BindingDB | Q8N4C6. |
| ChiTaRS | NIN. human. |
| GenomeRNAi | 51199. |
| NextBio | 54220. |
| SOURCE | Search... |
Entry information
| Entry name | NIN_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q8N4C6 Secondary accession number(s): A6NDB8 Q9UH61 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 14 Human chromosome 14: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
