Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Ninein

Gene

NIN

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Centrosomal protein required in the positioning and anchorage of the microtubule minus-end in epithelial cells. May also act as a centrosome maturation factor. May play a role in microtubule nucleation. Overexpression does not perturb nucleation or elongation of microtubules but suppresses release of microtubules (PubMed:15190203). Required for centriole organization and microtubule anchoring at the mother centriole (PubMed:23386061).2 Publications

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Nucleotide bindingi245 – 252GTPSequence analysis8
Nucleotide bindingi300 – 304GTPSequence analysis5
Nucleotide bindingi420 – 423GTPSequence analysis4

GO - Molecular functioni

GO - Biological processi

  • centrosome localization Source: HGNC
  • centrosome-templated microtubule nucleation Source: GO_Central
  • microtubule anchoring at centrosome Source: UniProtKB
Complete GO annotation...

Keywords - Ligandi

GTP-binding, Nucleotide-binding

Enzyme and pathway databases

SIGNORiQ8N4C6.

Names & Taxonomyi

Protein namesi
Recommended name:
Ninein
Short name:
hNinein
Alternative name(s):
Glycogen synthase kinase 3 beta-interacting protein
Short name:
GSK3B-interacting protein
Gene namesi
Name:NIN
Synonyms:KIAA1565
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 14

Organism-specific databases

HGNCiHGNC:14906. NIN.

Subcellular locationi

GO - Cellular componenti

  • centriole Source: UniProtKB
  • centrosome Source: UniProtKB
  • ciliary transition fiber Source: GO_Central
  • microtubule minus-end Source: GO_Central
  • mitotic spindle pole Source: GO_Central
  • nucleolus Source: HPA
  • pericentriolar material Source: MGI
  • spindle pole Source: MGI
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton, Microtubule

Pathology & Biotechi

Involvement in diseasei

Seckel syndrome 7 (SCKL7)1 Publication
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA rare autosomal recessive disorder characterized by proportionate dwarfism of prenatal onset associated with low birth weight, growth retardation, severe microcephaly with a bird-headed like appearance, and mental retardation.
See also OMIM:614851
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_0690831222Q → R in SCKL7; does not disrupt protein expression or localization or affect mitotic functions in an obvious way. 1 PublicationCorresponds to variant rs187464517dbSNPEnsembl.1
Natural variantiVAR_0690841709N → S in SCKL7; does not disrupt protein expression or localization or affect mitotic functions in an obvious way. 1 PublicationCorresponds to variant rs387907308dbSNPEnsembl.1

Keywords - Diseasei

Disease mutation, Dwarfism, Mental retardation

Organism-specific databases

DisGeNETi51199.
MalaCardsiNIN.
MIMi614851. phenotype.
OpenTargetsiENSG00000100503.
Orphaneti319675. Microcephalic primordial dwarfism, Dauber type.
PharmGKBiPA31630.

Polymorphism and mutation databases

BioMutaiNIN.
DMDMi311033487.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000968441 – 2090NineinAdd BLAST2090

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei152PhosphoserineCombined sources1
Modified residuei269PhosphoserineBy similarity1
Modified residuei1550PhosphoserineCombined sources1
Modified residuei1837PhosphoserineBy similarity1

Post-translational modificationi

Phosphorylated by AURKA/Aurora kinase A and PKA kinases but not CK2 or AURKB/ Aurora kinase B.1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ8N4C6.
MaxQBiQ8N4C6.
PaxDbiQ8N4C6.
PeptideAtlasiQ8N4C6.
PRIDEiQ8N4C6.

PTM databases

iPTMnetiQ8N4C6.
PhosphoSitePlusiQ8N4C6.

Expressioni

Tissue specificityi

Ubiquitous. Highly expressed in heart and skeletal muscle. Isoform 1 is more expressed than isoform 5.2 Publications

Developmental stagei

In interphase cells, it is localized in the centrosome. Decreases in metaphase and anaphase and reappears in telophase.1 Publication

Gene expression databases

BgeeiENSG00000100503.
ExpressionAtlasiQ8N4C6. baseline and differential.
GenevisibleiQ8N4C6. HS.

Organism-specific databases

HPAiHPA005939.

Interactioni

Subunit structurei

Homooligomer. Interacts with GSK3B/GSK3-beta via its C-terminal domain. Interacts with C14ORF166, such interaction may prevent its phosphorylation by GSK3B. Interacts with AUNIP (via N-terminus). Identified in a complex with AUNIP and AURKA.3 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
C14orf166Q9Y2244EBI-1164022,EBI-1104547
GSK3BP498413EBI-1164022,EBI-373586

Protein-protein interaction databases

BioGridi119372. 114 interactors.
IntActiQ8N4C6. 108 interactors.
MINTiMINT-1175275.
STRINGi9606.ENSP00000371472.

Structurei

3D structure databases

ProteinModelPortaliQ8N4C6.
SMRiQ8N4C6.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini8 – 43EF-hand 1PROSITE-ProRule annotationAdd BLAST36
Domaini42 – 77EF-hand 2PROSITE-ProRule annotationAdd BLAST36
Domaini182 – 217EF-hand 3PROSITE-ProRule annotationAdd BLAST36
Domaini219 – 252EF-hand 4PROSITE-ProRule annotationAdd BLAST34
Domaini317 – 352EF-hand 5PROSITE-ProRule annotationAdd BLAST36

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili357 – 570Sequence analysisAdd BLAST214
Coiled coili625 – 1027Sequence analysisAdd BLAST403
Coiled coili1068 – 1099Sequence analysisAdd BLAST32
Coiled coili1181 – 1341Sequence analysisAdd BLAST161
Coiled coili1441 – 1816Sequence analysisAdd BLAST376
Coiled coili1854 – 1885Sequence analysisAdd BLAST32
Coiled coili1922 – 2067Sequence analysisAdd BLAST146

Domaini

The coiled coil region from Asn-1611 to Pro-1693 is necessary and sufficient for the targeting to centrosome.

Sequence similaritiesi

Contains 5 EF-hand domains.PROSITE-ProRule annotation

Keywords - Domaini

Coiled coil, Repeat

Phylogenomic databases

eggNOGiENOG410IK59. Eukaryota.
ENOG410Z1RR. LUCA.
GeneTreeiENSGT00660000095541.
HOGENOMiHOG000293170.
HOVERGENiHBG052623.
InParanoidiQ8N4C6.
KOiK16476.
OMAiEHRIATM.
OrthoDBiEOG091G00XA.
PhylomeDBiQ8N4C6.
TreeFamiTF325139.

Family and domain databases

Gene3Di1.10.238.10. 2 hits.
InterProiIPR011992. EF-hand-dom_pair.
IPR002048. EF_hand_dom.
IPR029664. NIN.
[Graphical view]
PANTHERiPTHR18905:SF11. PTHR18905:SF11. 4 hits.
SUPFAMiSSF47473. SSF47473. 2 hits.
PROSITEiPS50222. EF_HAND_2. 5 hits.
[Graphical view]

Sequences (9)i

Sequence statusi: Complete.

This entry describes 9 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8N4C6-1) [UniParc]FASTAAdd to basket
Also known as: Lm

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MDEVEQDQHE ARLKELFDSF DTTGTGSLGQ EELTDLCHML SLEEVAPVLQ
60 70 80 90 100
QTLLQDNLLG RVHFDQFKEA LILILSRTLS NEEHFQEPDC SLEAQPKYVR
110 120 130 140 150
GGKRYGRRSL PEFQESVEEF PEVTVIEPLD EEARPSHIPA GDCSEHWKTQ
160 170 180 190 200
RSEEYEAEGQ LRFWNPDDLN ASQSGSSPPQ DWIEEKLQEV CEDLGITRDG
210 220 230 240 250
HLNRKKLVSI CEQYGLQNVD GEMLEEVFHN LDPDGTMSVE DFFYGLFKNG
260 270 280 290 300
KSLTPSASTP YRQLKRHLSM QSFDESGRRT TTSSAMTSTI GFRVFSCLDD
310 320 330 340 350
GMGHASVERI LDTWQEEGIE NSQEILKALD FSLDGNINLT ELTLALENEL
360 370 380 390 400
LVTKNSIHQA ALASFKAEIR HLLERVDQVV REKEKLRSDL DKAEKLKSLM
410 420 430 440 450
ASEVDDHHAA IERRNEYNLR KLDEEYKERI AALKNELRKE REQILQQAGK
460 470 480 490 500
QRLELEQEIE KAKTEENYIR DRLALSLKEN SRLENELLEN AEKLAEYENL
510 520 530 540 550
TNKLQRNLEN VLAEKFGDLD PSSAEFFLQE ERLTQMRNEY ERQCRVLQDQ
560 570 580 590 600
VDELQSELEE YRAQGRVLRL PLKNSPSEEV EANSGGIEPE HGLGSEECNP
610 620 630 640 650
LNMSIEAELV IEQMKEQHHR DICCLRLELE DKVRHYEKQL DETVVSCKKA
660 670 680 690 700
QENMKQRHEN ETHTLEKQIS DLKNEIAELQ GQAAVLKEAH HEATCRHEEE
710 720 730 740 750
KKQLQVKLEE EKTHLQEKLR LQHEMELKAR LTQAQASFER EREGLQSSAW
760 770 780 790 800
TEEKVRGLTQ ELEQFHQEQL TSLVEKHTLE KEELRKELLE KHQRELQEGR
810 820 830 840 850
EKMETECNRR TSQIEAQFQS DCQKVTERCE SALQSLEGRY RQELKDLQEQ
860 870 880 890 900
QREEKSQWEF EKDELTQECA EAQELLKETL KREKTTSLVL TQEREMLEKT
910 920 930 940 950
YKEHLNSMVV ERQQLLQDLE DLRNVSETQQ SLLSDQILEL KSSHKRELRE
960 970 980 990 1000
REEVLCQAGA SEQLASQRLE RLEMEHDQER QEMMSKLLAM ENIHKATCET
1010 1020 1030 1040 1050
ADRERAEMST EISRLQSKIK EMQQATSPLS MLQSGCQVIG EEEVEGDGAL
1060 1070 1080 1090 1100
SLLQQGEQLL EENGDVLLSL QRAHEQAVKE NVKMATEISR LQQRLQKLEP
1110 1120 1130 1140 1150
GLVMSSCLDE PATEFFGNTA EQTEQFLQQN RTKQVEGVTR RHVLSDLEDD
1160 1170 1180 1190 1200
EVRDLGSTGT SSVQRQEVKI EESEASVEGF SELENSEETR TESWELKNQI
1210 1220 1230 1240 1250
SQLQEQLMML CADCDRASEK KQDLLFDVSV LKKKLKMLER IPEASPKYKL
1260 1270 1280 1290 1300
LYEDVSREND CLQEELRMME TRYDEALENN KELTAEVFRL QDELKKMEEV
1310 1320 1330 1340 1350
TETFLSLEKS YDEVKIENEG LNVLVLRLQG KIEKLQESVV QRCDCCLWEA
1360 1370 1380 1390 1400
SLENLEIEPD GNILQLNQTL EECVPRVRSV HHVIEECKQE NQYLEGNTQL
1410 1420 1430 1440 1450
LEKVKAHEIA WLHGTIQTHQ ERPRVQNQVI LEENTTLLGF QDKHFQHQAT
1460 1470 1480 1490 1500
IAELELEKTK LQELTRKLKE RVTILVKQKD VLSHGEKEEE LKAMMHDLQI
1510 1520 1530 1540 1550
TCSEMQQKVE LLRYESEKLQ QENSILRNEI TTLNEEDSIS NLKLGTLNGS
1560 1570 1580 1590 1600
QEEMWQKTET VKQENAAVQK MVENLKKQIS ELKIKNQQLD LENTELSQKN
1610 1620 1630 1640 1650
SQNQEKLQEL NQRLTEMLCQ KEKEPGNSAL EEREQEKFNL KEELERCKVQ
1660 1670 1680 1690 1700
SSTLVSSLEA ELSEVKIQTH IVQQENHLLK DELEKMKQLH RCPDLSDFQQ
1710 1720 1730 1740 1750
KISSVLSYNE KLLKEKEALS EELNSCVDKL AKSSLLEHRI ATMKQEQKSW
1760 1770 1780 1790 1800
EHQSASLKSQ LVASQEKVQN LEDTVQNVNL QMSRMKSDLR VTQQEKEALK
1810 1820 1830 1840 1850
QEVMSLHKQL QNAGGKSWAP EIATHPSGLH NQQKRLSWDK LDHLMNEEQQ
1860 1870 1880 1890 1900
LLWQENERLQ TMVQNTKAEL THSREKVRQL ESNLLPKHQK HLNPSGTMNP
1910 1920 1930 1940 1950
TEQEKLSLKR ECDQFQKEQS PANRKVSQMN SLEQELETIH LENEGLKKKQ
1960 1970 1980 1990 2000
VKLDEQLMEM QHLRSTATPS PSPHAWDLQL LQQQACPMVP REQFLQLQRQ
2010 2020 2030 2040 2050
LLQAERINQH LQEELENRTS ETNTPQGNQE QLVTVMEERM IEVEQKLKLV
2060 2070 2080 2090
KRLLQEKVNQ LKEQVSLPGH LCSPTSHSSF NSSFTSLYCH
Length:2,090
Mass (Da):243,249
Last modified:November 2, 2010 - v4
Checksum:i51D27CD38A369209
GO
Isoform 2 (identifier: Q8N4C6-2) [UniParc]FASTAAdd to basket
Also known as: Isotype 3

The sequence of this isoform differs from the canonical sequence as follows:
     492-508: Missing.

Note: Dubious isoform produced through aberrant splice sites.
Show »
Length:2,073
Mass (Da):241,191
Checksum:i784E25AE5D1C68DE
GO
Isoform 3 (identifier: Q8N4C6-10) [UniParc]FASTAAdd to basket
Also known as: Isotype 2

The sequence of this isoform differs from the canonical sequence as follows:
     492-508: Missing.
     2065-2090: VSLPGHLCSPTSHSSFNSSFTSLYCH → LCKNTKADAM...PLTSTPPLRS

Note: Dubious isoform produced through aberrant splice sites.
Show »
Length:2,116
Mass (Da):246,135
Checksum:i0A9CEF8ECA2BF346
GO
Isoform 4 (identifier: Q8N4C6-4) [UniParc]FASTAAdd to basket
Also known as: Isotype 1

The sequence of this isoform differs from the canonical sequence as follows:
     492-508: Missing.
     2027-2046: GNQEQLVTVMEERMIEVEQK → ALLPEQRAVHADSYRRIGHL
     2047-2090: Missing.

Note: Dubious isoform produced through aberrant splice sites.
Show »
Length:2,029
Mass (Da):236,135
Checksum:iF994E939809252CB
GO
Isoform 5 (identifier: Q8N4C6-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-35: MDEVEQDQHEARLKELFDSFDTTGTGSLGQEELTD → MAEVTVPRVY...HRKIQHVKNE

Show »
Length:2,096
Mass (Da):243,889
Checksum:i32552AFD21D13A70
GO
Isoform 6 (identifier: Q8N4C6-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     800-1512: Missing.
     1555-1555: Missing.
     1960-1988: MQHLRSTATPSPSPHAWDLQLLQQQACPM → NSVVGSSREGCSSLPEIVCEDAAPEVHCDA
     1989-2090: Missing.

Note: No experimental confirmation available.
Show »
Length:1,275
Mass (Da):147,799
Checksum:iA34D34D74D9B861C
GO
Isoform 7 (identifier: Q8N4C6-7) [UniParc]FASTAAdd to basket
Also known as: B

The sequence of this isoform differs from the canonical sequence as follows:
     2065-2090: VSLPGHLCSPTSHSSFNSSFTSLYCH → LCKNTKADAM...PLTSTPPLRS

Note: No experimental confirmation available.
Show »
Length:2,133
Mass (Da):248,194
Checksum:i7B4B1C5A69FD4424
GO
Isoform 8 (identifier: Q8N4C6-9) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-38: Missing.

Note: No experimental confirmation available.
Show »
Length:2,052
Mass (Da):238,941
Checksum:i77E187FF00857A7D
GO
Isoform 9 (identifier: Q8N4C6-11) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     800-1512: Missing.

Note: No experimental confirmation available.
Show »
Length:1,377
Mass (Da):160,136
Checksum:i19AE5E3800593B03
GO

Sequence cautioni

The sequence AAH65521 differs from that shown. Contaminating sequence. Potential poly-A sequence.Curated
The sequence AAH65521 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
The sequence AAK00628 differs from that shown. Several sequencing errors.Curated
The sequence AAK00629 differs from that shown. Several sequencing errors and frameshifts.Curated
The sequence AAK00630 differs from that shown. Several sequencing errors.Curated
The sequence BAB13391 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
The sequence BAB15640 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti137H → Y in AAF23015 (PubMed:11004522).Curated1
Sequence conflicti137H → Y in AAG33512 (PubMed:11162463).Curated1
Sequence conflicti177S → F in AAF23015 (PubMed:11004522).Curated1
Sequence conflicti203N → D in AAG33512 (PubMed:11162463).Curated1
Sequence conflicti223M → I in AAG33512 (PubMed:11162463).Curated1
Sequence conflicti295F → I in AAG33512 (PubMed:11162463).Curated1
Sequence conflicti369I → V in AAG33512 (PubMed:11162463).Curated1
Sequence conflicti399L → S in AAG33512 (PubMed:11162463).Curated1
Sequence conflicti568L → F in AAG33512 (PubMed:11162463).Curated1
Sequence conflicti809R → I in AAF23015 (PubMed:11004522).Curated1
Sequence conflicti812S → T in AAG33512 (PubMed:11162463).Curated1
Sequence conflicti945K → I in AAG33512 (PubMed:11162463).Curated1
Sequence conflicti977D → A in AAG33512 (PubMed:11162463).Curated1
Sequence conflicti980R → G in AAF23015 (PubMed:11004522).Curated1
Sequence conflicti1054Q → H in AAG33512 (PubMed:11162463).Curated1
Sequence conflicti1067L → F in AAG33512 (PubMed:11162463).Curated1
Sequence conflicti1070L → Q in AAF23015 (PubMed:11004522).Curated1
Sequence conflicti1150D → G in AAF23015 (PubMed:11004522).Curated1
Sequence conflicti1237M → I in AAF23015 (PubMed:11004522).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_0194531111P → A.Corresponds to variant rs2236316dbSNPEnsembl.1
Natural variantiVAR_0512351125Q → P.3 PublicationsCorresponds to variant rs12882191dbSNPEnsembl.1
Natural variantiVAR_0690831222Q → R in SCKL7; does not disrupt protein expression or localization or affect mitotic functions in an obvious way. 1 PublicationCorresponds to variant rs187464517dbSNPEnsembl.1
Natural variantiVAR_0194541320G → E.4 PublicationsCorresponds to variant rs2073347dbSNPEnsembl.1
Natural variantiVAR_0690841709N → S in SCKL7; does not disrupt protein expression or localization or affect mitotic functions in an obvious way. 1 PublicationCorresponds to variant rs387907308dbSNPEnsembl.1
Natural variantiVAR_0194551837S → T.Corresponds to variant rs12717411dbSNPEnsembl.1
Natural variantiVAR_0512361934Q → E.Corresponds to variant rs2295847dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0400391 – 38Missing in isoform 8. 1 PublicationAdd BLAST38
Alternative sequenceiVSP_0109501 – 35MDEVE…EELTD → MAEVTVPRVYVVFGIHCIMA KASSDVQVSGFHRKIQHVKN E in isoform 5. 1 PublicationAdd BLAST35
Alternative sequenceiVSP_010952492 – 508Missing in isoform 2, isoform 3 and isoform 4. 2 PublicationsAdd BLAST17
Alternative sequenceiVSP_010953800 – 1512Missing in isoform 6 and isoform 9. 2 PublicationsAdd BLAST713
Alternative sequenceiVSP_0109541555Missing in isoform 6. 1 Publication1
Alternative sequenceiVSP_0109551960 – 1988MQHLR…QACPM → NSVVGSSREGCSSLPEIVCE DAAPEVHCDA in isoform 6. 1 PublicationAdd BLAST29
Alternative sequenceiVSP_0109561989 – 2090Missing in isoform 6. 1 PublicationAdd BLAST102
Alternative sequenceiVSP_0109572027 – 2046GNQEQ…EVEQK → ALLPEQRAVHADSYRRIGHL in isoform 4. 2 PublicationsAdd BLAST20
Alternative sequenceiVSP_0109582047 – 2090Missing in isoform 4. 2 PublicationsAdd BLAST44
Alternative sequenceiVSP_0109602065 – 2090VSLPG…SLYCH → LCKNTKADAMVKDLYVENAQ LLKALEVTEQRQKTAEKKNY LLEEKIASLSNIVRNLTPAP LTSTPPLRS in isoform 3 and isoform 7. 2 PublicationsAdd BLAST26

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF212162 mRNA. Translation: AAF23015.2.
AF302773 mRNA. Translation: AAG33512.2.
AF223937 mRNA. Translation: AAK00628.1. Sequence problems.
AF223938 mRNA. Translation: AAK00629.1. Sequence problems.
AF223939 mRNA. Translation: AAK00630.1. Sequence problems.
AB046785 mRNA. Translation: BAB13391.2. Different initiation.
AL133485 Genomic DNA. No translation available.
AL606834 Genomic DNA. No translation available.
BC034708 mRNA. Translation: AAH34708.2.
BC065521 mRNA. Translation: AAH65521.1. Sequence problems.
BC090932 mRNA. Translation: AAH90932.1.
AY027794 mRNA. Translation: AAK27375.1.
AY027795 mRNA. Translation: AAK27376.1.
AY027796 mRNA. Translation: AAK27377.1.
AF186776 mRNA. Translation: AAG17027.1.
AK027054 mRNA. Translation: BAB15640.1. Different initiation.
CCDSiCCDS32078.2. [Q8N4C6-11]
CCDS32079.1. [Q8N4C6-1]
RefSeqiNP_057434.4. NM_016350.4. [Q8N4C6-11]
NP_065972.3. NM_020921.3.
NP_891989.2. NM_182944.2.
NP_891991.1. NM_182946.1.
XP_011535125.1. XM_011536823.2. [Q8N4C6-5]
UniGeneiHs.310429.
Hs.569387.

Genome annotation databases

EnsembliENST00000245441; ENSP00000245441; ENSG00000100503. [Q8N4C6-7]
ENST00000324330; ENSP00000324210; ENSG00000100503. [Q8N4C6-11]
ENST00000382041; ENSP00000371472; ENSG00000100503. [Q8N4C6-1]
ENST00000382043; ENSP00000371474; ENSG00000100503. [Q8N4C6-11]
ENST00000530997; ENSP00000436092; ENSG00000100503. [Q8N4C6-7]
GeneIDi51199.
KEGGihsa:51199.
UCSCiuc001wyi.3. human. [Q8N4C6-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF212162 mRNA. Translation: AAF23015.2.
AF302773 mRNA. Translation: AAG33512.2.
AF223937 mRNA. Translation: AAK00628.1. Sequence problems.
AF223938 mRNA. Translation: AAK00629.1. Sequence problems.
AF223939 mRNA. Translation: AAK00630.1. Sequence problems.
AB046785 mRNA. Translation: BAB13391.2. Different initiation.
AL133485 Genomic DNA. No translation available.
AL606834 Genomic DNA. No translation available.
BC034708 mRNA. Translation: AAH34708.2.
BC065521 mRNA. Translation: AAH65521.1. Sequence problems.
BC090932 mRNA. Translation: AAH90932.1.
AY027794 mRNA. Translation: AAK27375.1.
AY027795 mRNA. Translation: AAK27376.1.
AY027796 mRNA. Translation: AAK27377.1.
AF186776 mRNA. Translation: AAG17027.1.
AK027054 mRNA. Translation: BAB15640.1. Different initiation.
CCDSiCCDS32078.2. [Q8N4C6-11]
CCDS32079.1. [Q8N4C6-1]
RefSeqiNP_057434.4. NM_016350.4. [Q8N4C6-11]
NP_065972.3. NM_020921.3.
NP_891989.2. NM_182944.2.
NP_891991.1. NM_182946.1.
XP_011535125.1. XM_011536823.2. [Q8N4C6-5]
UniGeneiHs.310429.
Hs.569387.

3D structure databases

ProteinModelPortaliQ8N4C6.
SMRiQ8N4C6.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi119372. 114 interactors.
IntActiQ8N4C6. 108 interactors.
MINTiMINT-1175275.
STRINGi9606.ENSP00000371472.

PTM databases

iPTMnetiQ8N4C6.
PhosphoSitePlusiQ8N4C6.

Polymorphism and mutation databases

BioMutaiNIN.
DMDMi311033487.

Proteomic databases

EPDiQ8N4C6.
MaxQBiQ8N4C6.
PaxDbiQ8N4C6.
PeptideAtlasiQ8N4C6.
PRIDEiQ8N4C6.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000245441; ENSP00000245441; ENSG00000100503. [Q8N4C6-7]
ENST00000324330; ENSP00000324210; ENSG00000100503. [Q8N4C6-11]
ENST00000382041; ENSP00000371472; ENSG00000100503. [Q8N4C6-1]
ENST00000382043; ENSP00000371474; ENSG00000100503. [Q8N4C6-11]
ENST00000530997; ENSP00000436092; ENSG00000100503. [Q8N4C6-7]
GeneIDi51199.
KEGGihsa:51199.
UCSCiuc001wyi.3. human. [Q8N4C6-1]

Organism-specific databases

CTDi51199.
DisGeNETi51199.
GeneCardsiNIN.
GeneReviewsiNIN.
HGNCiHGNC:14906. NIN.
HPAiHPA005939.
MalaCardsiNIN.
MIMi608684. gene.
614851. phenotype.
neXtProtiNX_Q8N4C6.
OpenTargetsiENSG00000100503.
Orphaneti319675. Microcephalic primordial dwarfism, Dauber type.
PharmGKBiPA31630.
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IK59. Eukaryota.
ENOG410Z1RR. LUCA.
GeneTreeiENSGT00660000095541.
HOGENOMiHOG000293170.
HOVERGENiHBG052623.
InParanoidiQ8N4C6.
KOiK16476.
OMAiEHRIATM.
OrthoDBiEOG091G00XA.
PhylomeDBiQ8N4C6.
TreeFamiTF325139.

Enzyme and pathway databases

SIGNORiQ8N4C6.

Miscellaneous databases

ChiTaRSiNIN. human.
GeneWikiiNIN_(gene).
GenomeRNAii51199.
PROiQ8N4C6.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000100503.
ExpressionAtlasiQ8N4C6. baseline and differential.
GenevisibleiQ8N4C6. HS.

Family and domain databases

Gene3Di1.10.238.10. 2 hits.
InterProiIPR011992. EF-hand-dom_pair.
IPR002048. EF_hand_dom.
IPR029664. NIN.
[Graphical view]
PANTHERiPTHR18905:SF11. PTHR18905:SF11. 4 hits.
SUPFAMiSSF47473. SSF47473. 2 hits.
PROSITEiPS50222. EF_HAND_2. 5 hits.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiNIN_HUMAN
AccessioniPrimary (citable) accession number: Q8N4C6
Secondary accession number(s): A6NDB8
, B7WPA3, C9JSB6, C9JSG2, C9JXL2, Q5BKU3, Q6P0P6, Q9BWU6, Q9C012, Q9C013, Q9C014, Q9H5I6, Q9HAT7, Q9HBY5, Q9HCK7, Q9UH61
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 19, 2004
Last sequence update: November 2, 2010
Last modified: November 30, 2016
This is version 137 of the entry and version 4 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Miscellaneous

Antibodies against NIN are present in sera from patients with autoimmune diseases that developed autoantibodies against centrosomal proteins.

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 14
    Human chromosome 14: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.