Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q8N4C6 (NIN_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 115. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (5) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Ninein

Short name=hNinein
Alternative name(s):
Glycogen synthase kinase 3 beta-interacting protein
Short name=GSK3B-interacting protein
Gene names
Name:NIN
Synonyms:KIAA1565
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length2090 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Centrosomal protein required in the positioning and anchorage of the microtubule minus-end in epithelial cells. May also act as a centrosome maturation factor. May play a role in microtubule nucleation. Overexpression does not perturb nucleation or elongation of microtubules but suppresses release of microtubules. Ref.3

Subunit structure

Homooligomer. Interacts with GSK3B/GSK3-beta via its C-terminal domain. Interacts with C14ORF166, such interaction may prevent its phosphorylation by GSK3B. Interacts with AUNIP (via N-terminus). Identified in a complex with AUNIP and AURKA. Ref.1 Ref.12 Ref.13 Ref.18

Subcellular location

Cytoplasmcytoskeletonmicrotubule organizing centercentrosome. Note: Component of the core centrosome. Arranged in a tubular conformation with an open and a closed end within the centrosome. In the mother centrosome, it localizes at both ends of the centrosome tube, including the site of centrosome duplication, while in the daughter centrosome it is present only at the closed end. Requires PCM1 for centrosome localization. Ref.1 Ref.3 Ref.10 Ref.11 Ref.12

Tissue specificity

Ubiquitous. Highly expressed in heart and skeletal muscle. Isoform 1 is more expressed than isoform 5. Ref.1 Ref.2

Developmental stage

In interphase cells, it is localized in the centrosome. Decreases in metaphase and anaphase and reappears in telophase. Ref.12

Domain

The coiled coil region from Asn-1611 to Pro-1693 is necessary and sufficient for the targeting to centrosome.

Post-translational modification

Phosphorylated by AURKA/Aurora kinase A and PKA kinases but not CK2 or AURKB/ Aurora kinase B. Ref.12

Involvement in disease

Seckel syndrome 7 (SCKL7) [MIM:614851]: A rare autosomal recessive disorder characterized by proportionate dwarfism of prenatal onset associated with low birth weight, growth retardation, severe microcephaly with a bird-headed like appearance, and mental retardation.
Note: The disease is caused by mutations affecting the gene represented in this entry. Ref.20

Miscellaneous

Antibodies against NIN are present in sera from patients with autoimmune diseases that developed autoantibodies against centrosomal proteins.

Sequence similarities

Contains 5 EF-hand domains.

Sequence caution

The sequence AAH65521.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.

The sequence AAH65521.1 differs from that shown. Reason: Contaminating sequence. Potential poly-A sequence.

The sequence AAK00628.1 differs from that shown. Reason: Several sequencing errors.

The sequence AAK00629.1 differs from that shown. Reason: Several sequencing errors and frameshifts.

The sequence AAK00630.1 differs from that shown. Reason: Several sequencing errors.

The sequence BAB13391.2 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.

The sequence BAB15640.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

Binary interactions

With

Entry

#Exp.

IntAct

Notes

C14orf166Q9Y2244EBI-1164022,EBI-1104547
GSK3BP498413EBI-1164022,EBI-373586

Alternative products

This entry describes 9 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q8N4C6-1)

Also known as: Lm;

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q8N4C6-2)

Also known as: Isotype 3;

The sequence of this isoform differs from the canonical sequence as follows:
     492-508: Missing.
Note: Dubious isoform produced through aberrant splice sites.
Isoform 3 (identifier: Q8N4C6-10)

Also known as: Isotype 2;

The sequence of this isoform differs from the canonical sequence as follows:
     492-508: Missing.
     2065-2090: VSLPGHLCSPTSHSSFNSSFTSLYCH → LCKNTKADAM...PLTSTPPLRS
Note: Dubious isoform produced through aberrant splice sites.
Isoform 4 (identifier: Q8N4C6-4)

Also known as: Isotype 1;

The sequence of this isoform differs from the canonical sequence as follows:
     492-508: Missing.
     2027-2046: GNQEQLVTVMEERMIEVEQK → ALLPEQRAVHADSYRRIGHL
     2047-2090: Missing.
Note: Dubious isoform produced through aberrant splice sites.
Isoform 5 (identifier: Q8N4C6-5)

The sequence of this isoform differs from the canonical sequence as follows:
     1-35: MDEVEQDQHEARLKELFDSFDTTGTGSLGQEELTD → MAEVTVPRVY...HRKIQHVKNE
Isoform 6 (identifier: Q8N4C6-6)

The sequence of this isoform differs from the canonical sequence as follows:
     800-1512: Missing.
     1555-1555: Missing.
     1960-1988: MQHLRSTATPSPSPHAWDLQLLQQQACPM → NSVVGSSREGCSSLPEIVCEDAAPEVHCDA
     1989-2090: Missing.
Note: No experimental confirmation available.
Isoform 7 (identifier: Q8N4C6-7)

Also known as: B;

The sequence of this isoform differs from the canonical sequence as follows:
     2065-2090: VSLPGHLCSPTSHSSFNSSFTSLYCH → LCKNTKADAM...PLTSTPPLRS
Note: No experimental confirmation available.
Isoform 8 (identifier: Q8N4C6-9)

The sequence of this isoform differs from the canonical sequence as follows:
     1-38: Missing.
Note: No experimental confirmation available.
Isoform 9 (identifier: Q8N4C6-11)

The sequence of this isoform differs from the canonical sequence as follows:
     800-1512: Missing.
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 20902090Ninein
PRO_0000096844

Regions

Domain8 – 4336EF-hand 1
Domain42 – 7736EF-hand 2
Domain182 – 21736EF-hand 3
Domain219 – 25234EF-hand 4
Domain317 – 35236EF-hand 5
Nucleotide binding245 – 2528GTP Potential
Nucleotide binding300 – 3045GTP Potential
Nucleotide binding420 – 4234GTP Potential
Coiled coil357 – 570214 Potential
Coiled coil625 – 1027403 Potential
Coiled coil1068 – 109932 Potential
Coiled coil1181 – 1341161 Potential
Coiled coil1441 – 1816376 Potential
Coiled coil1854 – 188532 Potential
Coiled coil1922 – 2067146 Potential

Amino acid modifications

Modified residue15501Phosphoserine Ref.16 Ref.17

Natural variations

Alternative sequence1 – 3838Missing in isoform 8.
VSP_040039
Alternative sequence1 – 3535MDEVE…EELTD → MAEVTVPRVYVVFGIHCIMA KASSDVQVSGFHRKIQHVKN E in isoform 5.
VSP_010950
Alternative sequence492 – 50817Missing in isoform 2, isoform 3 and isoform 4.
VSP_010952
Alternative sequence800 – 1512713Missing in isoform 6 and isoform 9.
VSP_010953
Alternative sequence15551Missing in isoform 6.
VSP_010954
Alternative sequence1960 – 198829MQHLR…QACPM → NSVVGSSREGCSSLPEIVCE DAAPEVHCDA in isoform 6.
VSP_010955
Alternative sequence1989 – 2090102Missing in isoform 6.
VSP_010956
Alternative sequence2027 – 204620GNQEQ…EVEQK → ALLPEQRAVHADSYRRIGHL in isoform 4.
VSP_010957
Alternative sequence2047 – 209044Missing in isoform 4.
VSP_010958
Alternative sequence2065 – 209026VSLPG…SLYCH → LCKNTKADAMVKDLYVENAQ LLKALEVTEQRQKTAEKKNY LLEEKIASLSNIVRNLTPAP LTSTPPLRS in isoform 3 and isoform 7.
VSP_010960
Natural variant11111P → A.
Corresponds to variant rs2236316 [ dbSNP | Ensembl ].
VAR_019453
Natural variant11251Q → P. Ref.1 Ref.2 Ref.3
Corresponds to variant rs12882191 [ dbSNP | Ensembl ].
VAR_051235
Natural variant12221Q → R in SCKL7; does not disrupt protein expression or localization or affect mitotic functions in an obvious way. Ref.20
Corresponds to variant rs187464517 [ dbSNP | Ensembl ].
VAR_069083
Natural variant13201G → E. Ref.1 Ref.2 Ref.3 Ref.19
Corresponds to variant rs2073347 [ dbSNP | Ensembl ].
VAR_019454
Natural variant17091N → S in SCKL7; does not disrupt protein expression or localization or affect mitotic functions in an obvious way. Ref.20
VAR_069084
Natural variant18371S → T.
Corresponds to variant rs12717411 [ dbSNP | Ensembl ].
VAR_019455
Natural variant19341Q → E.
Corresponds to variant rs2295847 [ dbSNP | Ensembl ].
VAR_051236

Experimental info

Sequence conflict1371H → Y in AAF23015. Ref.1
Sequence conflict1371H → Y in AAG33512. Ref.2
Sequence conflict1771S → F in AAF23015. Ref.1
Sequence conflict2031N → D in AAG33512. Ref.2
Sequence conflict2231M → I in AAG33512. Ref.2
Sequence conflict2951F → I in AAG33512. Ref.2
Sequence conflict3691I → V in AAG33512. Ref.2
Sequence conflict3991L → S in AAG33512. Ref.2
Sequence conflict5681L → F in AAG33512. Ref.2
Sequence conflict8091R → I in AAF23015. Ref.1
Sequence conflict8121S → T in AAG33512. Ref.2
Sequence conflict9451K → I in AAG33512. Ref.2
Sequence conflict9771D → A in AAG33512. Ref.2
Sequence conflict9801R → G in AAF23015. Ref.1
Sequence conflict10541Q → H in AAG33512. Ref.2
Sequence conflict10671L → F in AAG33512. Ref.2
Sequence conflict10701L → Q in AAF23015. Ref.1
Sequence conflict11501D → G in AAF23015. Ref.1
Sequence conflict12371M → I in AAF23015. Ref.1

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 (Lm) [UniParc].

Last modified November 2, 2010. Version 4.
Checksum: 51D27CD38A369209

FASTA2,090243,249
        10         20         30         40         50         60 
MDEVEQDQHE ARLKELFDSF DTTGTGSLGQ EELTDLCHML SLEEVAPVLQ QTLLQDNLLG 

        70         80         90        100        110        120 
RVHFDQFKEA LILILSRTLS NEEHFQEPDC SLEAQPKYVR GGKRYGRRSL PEFQESVEEF 

       130        140        150        160        170        180 
PEVTVIEPLD EEARPSHIPA GDCSEHWKTQ RSEEYEAEGQ LRFWNPDDLN ASQSGSSPPQ 

       190        200        210        220        230        240 
DWIEEKLQEV CEDLGITRDG HLNRKKLVSI CEQYGLQNVD GEMLEEVFHN LDPDGTMSVE 

       250        260        270        280        290        300 
DFFYGLFKNG KSLTPSASTP YRQLKRHLSM QSFDESGRRT TTSSAMTSTI GFRVFSCLDD 

       310        320        330        340        350        360 
GMGHASVERI LDTWQEEGIE NSQEILKALD FSLDGNINLT ELTLALENEL LVTKNSIHQA 

       370        380        390        400        410        420 
ALASFKAEIR HLLERVDQVV REKEKLRSDL DKAEKLKSLM ASEVDDHHAA IERRNEYNLR 

       430        440        450        460        470        480 
KLDEEYKERI AALKNELRKE REQILQQAGK QRLELEQEIE KAKTEENYIR DRLALSLKEN 

       490        500        510        520        530        540 
SRLENELLEN AEKLAEYENL TNKLQRNLEN VLAEKFGDLD PSSAEFFLQE ERLTQMRNEY 

       550        560        570        580        590        600 
ERQCRVLQDQ VDELQSELEE YRAQGRVLRL PLKNSPSEEV EANSGGIEPE HGLGSEECNP 

       610        620        630        640        650        660 
LNMSIEAELV IEQMKEQHHR DICCLRLELE DKVRHYEKQL DETVVSCKKA QENMKQRHEN 

       670        680        690        700        710        720 
ETHTLEKQIS DLKNEIAELQ GQAAVLKEAH HEATCRHEEE KKQLQVKLEE EKTHLQEKLR 

       730        740        750        760        770        780 
LQHEMELKAR LTQAQASFER EREGLQSSAW TEEKVRGLTQ ELEQFHQEQL TSLVEKHTLE 

       790        800        810        820        830        840 
KEELRKELLE KHQRELQEGR EKMETECNRR TSQIEAQFQS DCQKVTERCE SALQSLEGRY 

       850        860        870        880        890        900 
RQELKDLQEQ QREEKSQWEF EKDELTQECA EAQELLKETL KREKTTSLVL TQEREMLEKT 

       910        920        930        940        950        960 
YKEHLNSMVV ERQQLLQDLE DLRNVSETQQ SLLSDQILEL KSSHKRELRE REEVLCQAGA 

       970        980        990       1000       1010       1020 
SEQLASQRLE RLEMEHDQER QEMMSKLLAM ENIHKATCET ADRERAEMST EISRLQSKIK 

      1030       1040       1050       1060       1070       1080 
EMQQATSPLS MLQSGCQVIG EEEVEGDGAL SLLQQGEQLL EENGDVLLSL QRAHEQAVKE 

      1090       1100       1110       1120       1130       1140 
NVKMATEISR LQQRLQKLEP GLVMSSCLDE PATEFFGNTA EQTEQFLQQN RTKQVEGVTR 

      1150       1160       1170       1180       1190       1200 
RHVLSDLEDD EVRDLGSTGT SSVQRQEVKI EESEASVEGF SELENSEETR TESWELKNQI 

      1210       1220       1230       1240       1250       1260 
SQLQEQLMML CADCDRASEK KQDLLFDVSV LKKKLKMLER IPEASPKYKL LYEDVSREND 

      1270       1280       1290       1300       1310       1320 
CLQEELRMME TRYDEALENN KELTAEVFRL QDELKKMEEV TETFLSLEKS YDEVKIENEG 

      1330       1340       1350       1360       1370       1380 
LNVLVLRLQG KIEKLQESVV QRCDCCLWEA SLENLEIEPD GNILQLNQTL EECVPRVRSV 

      1390       1400       1410       1420       1430       1440 
HHVIEECKQE NQYLEGNTQL LEKVKAHEIA WLHGTIQTHQ ERPRVQNQVI LEENTTLLGF 

      1450       1460       1470       1480       1490       1500 
QDKHFQHQAT IAELELEKTK LQELTRKLKE RVTILVKQKD VLSHGEKEEE LKAMMHDLQI 

      1510       1520       1530       1540       1550       1560 
TCSEMQQKVE LLRYESEKLQ QENSILRNEI TTLNEEDSIS NLKLGTLNGS QEEMWQKTET 

      1570       1580       1590       1600       1610       1620 
VKQENAAVQK MVENLKKQIS ELKIKNQQLD LENTELSQKN SQNQEKLQEL NQRLTEMLCQ 

      1630       1640       1650       1660       1670       1680 
KEKEPGNSAL EEREQEKFNL KEELERCKVQ SSTLVSSLEA ELSEVKIQTH IVQQENHLLK 

      1690       1700       1710       1720       1730       1740 
DELEKMKQLH RCPDLSDFQQ KISSVLSYNE KLLKEKEALS EELNSCVDKL AKSSLLEHRI 

      1750       1760       1770       1780       1790       1800 
ATMKQEQKSW EHQSASLKSQ LVASQEKVQN LEDTVQNVNL QMSRMKSDLR VTQQEKEALK 

      1810       1820       1830       1840       1850       1860 
QEVMSLHKQL QNAGGKSWAP EIATHPSGLH NQQKRLSWDK LDHLMNEEQQ LLWQENERLQ 

      1870       1880       1890       1900       1910       1920 
TMVQNTKAEL THSREKVRQL ESNLLPKHQK HLNPSGTMNP TEQEKLSLKR ECDQFQKEQS 

      1930       1940       1950       1960       1970       1980 
PANRKVSQMN SLEQELETIH LENEGLKKKQ VKLDEQLMEM QHLRSTATPS PSPHAWDLQL 

      1990       2000       2010       2020       2030       2040 
LQQQACPMVP REQFLQLQRQ LLQAERINQH LQEELENRTS ETNTPQGNQE QLVTVMEERM 

      2050       2060       2070       2080       2090 
IEVEQKLKLV KRLLQEKVNQ LKEQVSLPGH LCSPTSHSSF NSSFTSLYCH 

« Hide

Isoform 2 (Isotype 3) [UniParc].

Checksum: 784E25AE5D1C68DE
Show »

FASTA2,073241,191
Isoform 3 (Isotype 2) [UniParc].

Checksum: 0A9CEF8ECA2BF346
Show »

FASTA2,116246,135
Isoform 4 (Isotype 1) [UniParc].

Checksum: F994E939809252CB
Show »

FASTA2,029236,135
Isoform 5 [UniParc].

Checksum: 32552AFD21D13A70
Show »

FASTA2,096243,889
Isoform 6 [UniParc].

Checksum: A34D34D74D9B861C
Show »

FASTA1,275147,799
Isoform 7 (B) [UniParc].

Checksum: 7B4B1C5A69FD4424
Show »

FASTA2,133248,194
Isoform 8 [UniParc].

Checksum: 77E187FF00857A7D
Show »

FASTA2,052238,941
Isoform 9 [UniParc].

Checksum: 19AE5E3800593B03
Show »

FASTA1,377160,136

References

« Hide 'large scale' references
[1]"Cloning and characterization of a novel human ninein protein that interacts with the glycogen synthase kinase 3beta."
Hong Y.-R., Chen C.-H., Chang J.-H., Wang S.-K., Sy W.-D., Chou C.-K., Howng S.-L.
Biochim. Biophys. Acta 1492:513-516(2000) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 5), SUBCELLULAR LOCATION, TISSUE SPECIFICITY, INTERACTION WITH GSK3B, VARIANTS PRO-1125 AND GLU-1320.
Tissue: Fetal liver.
[2]"Genomic organization and molecular characterization of the human ninein gene."
Hong Y.-R., Chen C.-H., Chuo M.-H., Liou S.-Y., Howng S.-L.
Biochem. Biophys. Res. Commun. 279:989-995(2000) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY, VARIANTS PRO-1125 AND GLU-1320.
[3]"Human ninein is a centrosomal autoantigen recognized by CREST patient sera and plays a regulatory role in microtubule nucleation."
Stillwell E.E., Zhou J., Joshi H.C.
Cell Cycle 3:923-930(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2 AND 4), PARTIAL NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), FUNCTION, ALTERNATIVE SPLICING, SUBCELLULAR LOCATION, VARIANTS PRO-1125 AND GLU-1320.
Tissue: Thymus.
[4]"Prediction of the coding sequences of unidentified human genes. XVIII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."
Nagase T., Kikuno R., Nakayama M., Hirosawa M., Ohara O.
DNA Res. 7:273-281(2000) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 6).
Tissue: Brain.
[5]"Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones."
Nakajima D., Okazaki N., Yamakawa H., Kikuno R., Ohara O., Nagase T.
DNA Res. 9:99-106(2002) [PubMed] [Europe PMC] [Abstract]
Cited for: SEQUENCE REVISION.
[6]"The DNA sequence and analysis of human chromosome 14."
Heilig R., Eckenberg R., Petit J.-L., Fonknechten N., Da Silva C., Cattolico L., Levy M., Barbe V., De Berardinis V., Ureta-Vidal A., Pelletier E., Vico V., Anthouard V., Rowen L., Madan A., Qin S., Sun H., Du H. expand/collapse author list , Pepin K., Artiguenave F., Robert C., Cruaud C., Bruels T., Jaillon O., Friedlander L., Samson G., Brottier P., Cure S., Segurens B., Aniere F., Samain S., Crespeau H., Abbasi N., Aiach N., Boscus D., Dickhoff R., Dors M., Dubois I., Friedman C., Gouyvenoux M., James R., Madan A., Mairey-Estrada B., Mangenot S., Martins N., Menard M., Oztas S., Ratcliffe A., Shaffer T., Trask B., Vacherie B., Bellemere C., Belser C., Besnard-Gonnet M., Bartol-Mavel D., Boutard M., Briez-Silla S., Combette S., Dufosse-Laurent V., Ferron C., Lechaplais C., Louesse C., Muselet D., Magdelenat G., Pateau E., Petit E., Sirvain-Trukniewicz P., Trybou A., Vega-Czarny N., Bataille E., Bluet E., Bordelais I., Dubois M., Dumont C., Guerin T., Haffray S., Hammadi R., Muanga J., Pellouin V., Robert D., Wunderle E., Gauguet G., Roy A., Sainte-Marthe L., Verdier J., Verdier-Discala C., Hillier L.W., Fulton L., McPherson J., Matsuda F., Wilson R., Scarpelli C., Gyapay G., Wincker P., Saurin W., Quetier F., Waterston R., Hood L., Weissenbach J.
Nature 421:601-607(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[7]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 9), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-434 (ISOFORM 8), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1877-2090 (ISOFORM 4).
Tissue: Lymph.
[8]"3' isoforms of human ninein."
Choquette M.C., de Medicis E.
Submitted (FEB-2001) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1561-2090 (ISOFORMS 1 AND 7).
Tissue: Bone marrow.
[9]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1928-2090 (ISOFORM 7).
Tissue: Hepatoma.
[10]"CEP110 and ninein are located in a specific domain of the centrosome associated with centrosome maturation."
Ou Y.Y., Mack G.J., Zhang M., Rattner J.B.
J. Cell Sci. 115:1825-1835(2002) [PubMed] [Europe PMC] [Abstract]
Cited for: SUBCELLULAR LOCATION.
[11]"Assembly of centrosomal proteins and microtubule organization depends on PCM-1."
Dammermann A., Merdes A.
J. Cell Biol. 159:255-266(2002) [PubMed] [Europe PMC] [Abstract]
Cited for: SUBCELLULAR LOCATION.
[12]"Molecular characterization of human ninein protein: two distinct subdomains required for centrosomal targeting and regulating signals in cell cycle."
Chen C.-H., Howng S.-L., Cheng T.-S., Chou M.-H., Huang C.-Y., Hong Y.-R.
Biochem. Biophys. Res. Commun. 308:975-983(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: HOMOOLIGOMERIZATION, SUBCELLULAR LOCATION, DEVELOPMENTAL STAGE, PHOSPHORYLATION.
[13]"A novel ninein-interaction protein, CGI-99, blocks ninein phosphorylation by GSK3beta and is highly expressed in brain tumors."
Howng S.-L., Hsu H.-C., Cheng T.-S., Lee Y.-L., Chang L.-K., Lu P.-J., Hong Y.-R.
FEBS Lett. 566:162-168(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: INTERACTION WITH C14ORF166.
[14]"Autoantibodies to a group of centrosomal proteins in human autoimmune sera reactive with the centrosome."
Mack G.J., Rees J., Sandblom O., Balczon R., Fritzler M.J., Rattner J.B.
Arthritis Rheum. 41:551-558(1998) [PubMed] [Europe PMC] [Abstract]
Cited for: AUTOANTIBODY.
[15]"Spectrum of centrosome autoantibodies in childhood varicella and post-varicella acute cerebellar ataxia."
Fritzler M.J., Zhang M., Stinton L.M., Rattner J.B.
BMC Pediatr. 3:11-11(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: AUTOANTIBODY.
[16]"ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage."
Matsuoka S., Ballif B.A., Smogorzewska A., McDonald E.R. III, Hurov K.E., Luo J., Bakalarski C.E., Zhao Z., Solimini N., Lerenthal Y., Shiloh Y., Gygi S.P., Elledge S.J.
Science 316:1160-1166(2007) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1550, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Embryonic kidney.
[17]"Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1550, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Leukemic T-cell.
[18]"Functional characterization of AIBp, a novel Aurora-A binding protein in centrosome structure and spindle formation."
Lieu A.S., Cheng T.S., Chou C.H., Wu C.H., Hsu C.Y., Huang C.Y., Chang L.K., Loh J.K., Chang C.S., Hsu C.M., Howng S.L., Hong Y.R.
Int. J. Oncol. 37:429-436(2010) [PubMed] [Europe PMC] [Abstract]
Cited for: INTERACTION WITH AUNIP.
[19]"DNA sequencing of a cytogenetically normal acute myeloid leukaemia genome."
Ley T.J., Mardis E.R., Ding L., Fulton B., McLellan M.D., Chen K., Dooling D., Dunford-Shore B.H., McGrath S., Hickenbotham M., Cook L., Abbott R., Larson D.E., Koboldt D.C., Pohl C., Smith S., Hawkins A., Abbott S. expand/collapse author list , Locke D., Hillier L.W., Miner T., Fulton L., Magrini V., Wylie T., Glasscock J., Conyers J., Sander N., Shi X., Osborne J.R., Minx P., Gordon D., Chinwalla A., Zhao Y., Ries R.E., Payton J.E., Westervelt P., Tomasson M.H., Watson M., Baty J., Ivanovich J., Heath S., Shannon W.D., Nagarajan R., Walter M.J., Link D.C., Graubert T.A., DiPersio J.F., Wilson R.K.
Nature 456:66-72(2008) [PubMed] [Europe PMC] [Abstract]
Cited for: VARIANT [LARGE SCALE ANALYSIS] GLU-1320.
[20]"Novel microcephalic primordial dwarfism disorder associated with variants in the centrosomal protein ninein."
Dauber A., Lafranchi S.H., Maliga Z., Lui J.C., Moon J.E., McDeed C., Henke K., Zonana J., Kingman G.A., Pers T.H., Baron J., Rosenfeld R.G., Hirschhorn J.N., Harris M.P., Hwa V.
J. Clin. Endocrinol. Metab. 97:E2140-E2151(2012) [PubMed] [Europe PMC] [Abstract]
Cited for: VARIANTS SCKL7 ARG-1222 AND SER-1709.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AF212162 mRNA. Translation: AAF23015.2.
AF302773 mRNA. Translation: AAG33512.2.
AF223937 mRNA. Translation: AAK00628.1. Sequence problems.
AF223938 mRNA. Translation: AAK00629.1. Sequence problems.
AF223939 mRNA. Translation: AAK00630.1. Sequence problems.
AB046785 mRNA. Translation: BAB13391.2. Different initiation.
AL133485 Genomic DNA. No translation available.
AL606834 Genomic DNA. No translation available.
BC034708 mRNA. Translation: AAH34708.2.
BC065521 mRNA. Translation: AAH65521.1. Sequence problems.
BC090932 mRNA. Translation: AAH90932.1.
AY027794 mRNA. Translation: AAK27375.1.
AY027795 mRNA. Translation: AAK27376.1.
AY027796 mRNA. Translation: AAK27377.1.
AF186776 mRNA. Translation: AAG17027.1.
AK027054 mRNA. Translation: BAB15640.1. Different initiation.
CCDSCCDS32078.2. [Q8N4C6-11]
CCDS32079.1. [Q8N4C6-1]
RefSeqNP_057434.4. NM_016350.4. [Q8N4C6-11]
NP_065972.3. NM_020921.3.
NP_891989.2. NM_182944.2.
NP_891991.1. NM_182946.1.
UniGeneHs.310429.
Hs.569387.

3D structure databases

ProteinModelPortalQ8N4C6.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid119372. 8 interactions.
IntActQ8N4C6. 6 interactions.
MINTMINT-1175275.

Chemistry

BindingDBQ8N4C6.

PTM databases

PhosphoSiteQ8N4C6.

Polymorphism databases

DMDM311033487.

Proteomic databases

MaxQBQ8N4C6.
PaxDbQ8N4C6.
PRIDEQ8N4C6.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000245441; ENSP00000245441; ENSG00000100503. [Q8N4C6-7]
ENST00000382041; ENSP00000371472; ENSG00000100503. [Q8N4C6-1]
ENST00000382043; ENSP00000371474; ENSG00000100503. [Q8N4C6-11]
ENST00000530997; ENSP00000436092; ENSG00000100503. [Q8N4C6-7]
GeneID51199.
KEGGhsa:51199.
UCSCuc001wyi.3. human. [Q8N4C6-7]
uc001wyk.3. human. [Q8N4C6-11]
uc001wym.2. human. [Q8N4C6-1]

Organism-specific databases

CTD51199.
GeneCardsGC14M051187.
GeneReviewsNIN.
HGNCHGNC:14906. NIN.
HPAHPA005939.
MIM608684. gene.
614851. phenotype.
neXtProtNX_Q8N4C6.
Orphanet319675. Microcephalic primordial dwarfism, Dauber type.
PharmGKBPA31630.
HUGESearch...
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG124644.
HOGENOMHOG000293170.
HOVERGENHBG052623.
KOK16476.
OMAAMMHDLQ.
PhylomeDBQ8N4C6.
TreeFamTF325139.

Gene expression databases

ArrayExpressQ8N4C6.
BgeeQ8N4C6.
GenevestigatorQ8N4C6.

Family and domain databases

Gene3D1.10.238.10. 2 hits.
InterProIPR011992. EF-hand-dom_pair.
IPR002048. EF_hand_dom.
[Graphical view]
PfamPF13405. EF-hand_6. 1 hit.
[Graphical view]
PROSITEPS50222. EF_HAND_2. 5 hits.
[Graphical view]
ProtoNetSearch...

Other

ChiTaRSNIN. human.
GeneWikiNIN_(gene).
GenomeRNAi51199.
NextBio54220.
PROQ8N4C6.
SOURCESearch...

Entry information

Entry nameNIN_HUMAN
AccessionPrimary (citable) accession number: Q8N4C6
Secondary accession number(s): A6NDB8 expand/collapse secondary AC list , B7WPA3, C9JSB6, C9JSG2, C9JXL2, Q5BKU3, Q6P0P6, Q9BWU6, Q9C012, Q9C013, Q9C014, Q9H5I6, Q9HAT7, Q9HBY5, Q9HCK7, Q9UH61
Entry history
Integrated into UniProtKB/Swiss-Prot: July 19, 2004
Last sequence update: November 2, 2010
Last modified: July 9, 2014
This is version 115 of the entry and version 4 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 14

Human chromosome 14: entries, gene names and cross-references to MIM