Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Polypeptide N-acetylgalactosaminyltransferase 16

Gene

GALNT16

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Catalyzes the initial reaction in O-linked oligosaccharide biosynthesis, the transfer of an N-acetyl-D-galactosamine residue to a serine or threonine residue on the protein receptor.1 Publication

Catalytic activityi

UDP-N-acetyl-alpha-D-galactosamine + polypeptide = UDP + N-acetyl-alpha-D-galactosaminyl-polypeptide.1 Publication

Cofactori

Mn2+By similarity

Kineticsi

  1. KM=251 µM for Muc5AC1 Publication
  2. KM=310 µM for Muc5AC-31 Publication
  3. KM=390 µM for Muc5AC-131 Publication
  4. KM=332 µM for EA21 Publication

    Pathwayi: protein glycosylation

    This protein is involved in the pathway protein glycosylation, which is part of Protein modification.
    View all proteins of this organism that are known to be involved in the pathway protein glycosylation and in Protein modification.

    Sites

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    Binding sitei163SubstrateBy similarity1
    Binding sitei188SubstrateBy similarity1
    Metal bindingi211ManganeseBy similarity1
    Binding sitei212SubstrateBy similarity1
    Metal bindingi213ManganeseBy similarity1
    Binding sitei317SubstrateBy similarity1
    Metal bindingi345ManganeseBy similarity1
    Binding sitei348SubstrateBy similarity1
    Binding sitei351SubstrateBy similarity1
    Binding sitei353SubstrateBy similarity1

    GO - Molecular functioni

    GO - Biological processi

    • protein O-linked glycosylation via serine Source: UniProtKB
    • protein O-linked glycosylation via threonine Source: UniProtKB

    Keywordsi

    Molecular functionGlycosyltransferase, Transferase
    LigandLectin, Manganese, Metal-binding

    Enzyme and pathway databases

    ReactomeiR-HSA-913709 O-linked glycosylation of mucins
    UniPathwayiUPA00378

    Protein family/group databases

    CAZyiCBM13 Carbohydrate-Binding Module Family 13
    GT27 Glycosyltransferase Family 27

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Polypeptide N-acetylgalactosaminyltransferase 16 (EC:2.4.1.41)
    Alternative name(s):
    Polypeptide GalNAc transferase 16
    Short name:
    GalNAc-T16
    Polypeptide GalNAc transferase-like protein 1
    Short name:
    GalNAc-T-like protein 1
    Short name:
    pp-GaNTase-like protein 1
    Polypeptide N-acetylgalactosaminyltransferase-like protein 1
    Protein-UDP acetylgalactosaminyltransferase-like protein 1
    UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase-like protein 1
    Gene namesi
    Name:GALNT16
    Synonyms:GALNTL1, KIAA1130
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    Proteomesi

    Organism-specific databases

    EuPathDBiHostDB:ENSG00000100626.16
    HGNCiHGNC:23233 GALNT16
    MIMi615132 gene
    neXtProtiNX_Q8N428

    Subcellular locationi

    Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

    Topology

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    Topological domaini1 – 6CytoplasmicSequence analysis6
    Transmembranei7 – 26Helical; Signal-anchor for type II membrane proteinSequence analysisAdd BLAST20
    Topological domaini27 – 558LumenalSequence analysisAdd BLAST532

    Keywords - Cellular componenti

    Golgi apparatus, Membrane

    Pathology & Biotechi

    Organism-specific databases

    DisGeNETi57452
    OpenTargetsiENSG00000100626
    PharmGKBiPA134991608

    Polymorphism and mutation databases

    BioMutaiGALNT16
    DMDMi51316024

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    ChainiPRO_00000591351 – 558Polypeptide N-acetylgalactosaminyltransferase 16Add BLAST558

    Amino acid modifications

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    Disulfide bondi113 ↔ 340PROSITE-ProRule annotation
    Disulfide bondi331 ↔ 409PROSITE-ProRule annotation
    Disulfide bondi441 ↔ 460PROSITE-ProRule annotation
    Disulfide bondi486 ↔ 506PROSITE-ProRule annotation
    Disulfide bondi530 ↔ 543PROSITE-ProRule annotation

    Keywords - PTMi

    Disulfide bond

    Proteomic databases

    EPDiQ8N428
    MaxQBiQ8N428
    PaxDbiQ8N428
    PeptideAtlasiQ8N428
    PRIDEiQ8N428

    PTM databases

    iPTMnetiQ8N428
    PhosphoSitePlusiQ8N428

    Expressioni

    Gene expression databases

    BgeeiENSG00000100626
    CleanExiHS_GALNTL1
    ExpressionAtlasiQ8N428 baseline and differential
    GenevisibleiQ8N428 HS

    Organism-specific databases

    HPAiHPA059136

    Interactioni

    Protein-protein interaction databases

    BioGridi121524, 8 interactors
    STRINGi9606.ENSP00000336729

    Structurei

    3D structure databases

    ProteinModelPortaliQ8N428
    SMRiQ8N428
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    Domaini428 – 555Ricin B-type lectinPROSITE-ProRule annotationAdd BLAST128

    Region

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    Regioni122 – 227Catalytic subdomain AAdd BLAST106
    Regioni286 – 348Catalytic subdomain BAdd BLAST63

    Domaini

    There are two conserved domains in the glycosyltransferase region: the N-terminal domain (domain A, also called GT1 motif), which is probably involved in manganese coordination and substrate binding and the C-terminal domain (domain B, also called Gal/GalNAc-T motif), which is probably involved in catalytic reaction and UDP-Gal binding.By similarity
    The ricin B-type lectin domain binds to GalNAc and contributes to the glycopeptide specificity.By similarity

    Sequence similaritiesi

    Keywords - Domaini

    Signal-anchor, Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiKOG3738 Eukaryota
    ENOG410XPRX LUCA
    GeneTreeiENSGT00760000118828
    HOGENOMiHOG000038227
    HOVERGENiHBG051699
    InParanoidiQ8N428
    KOiK00710
    OMAiDPEDCQL
    OrthoDBiEOG091G085O
    PhylomeDBiQ8N428
    TreeFamiTF313267

    Family and domain databases

    CDDicd00161 RICIN, 1 hit
    Gene3Di3.90.550.10, 1 hit
    InterProiView protein in InterPro
    IPR001173 Glyco_trans_2-like
    IPR029044 Nucleotide-diphossugar_trans
    IPR035992 Ricin_B-like_lectins
    IPR000772 Ricin_B_lectin
    PfamiView protein in Pfam
    PF00535 Glycos_transf_2, 1 hit
    PF00652 Ricin_B_lectin, 1 hit
    SMARTiView protein in SMART
    SM00458 RICIN, 1 hit
    SUPFAMiSSF50370 SSF50370, 1 hit
    SSF53448 SSF53448, 1 hit
    PROSITEiView protein in PROSITE
    PS50231 RICIN_B_LECTIN, 1 hit

    Sequences (2)i

    Sequence statusi: Complete.

    This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

    Isoform 1 (identifier: Q8N428-1) [UniParc]FASTAAdd to basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

            10         20         30         40         50
    MRKIRANAIA ILTVAWILGT FYYLWQDNRA HAASSGGRGA QRAGRRSEQL
    60 70 80 90 100
    REDRTIPLIV TGTPSKGFDE KAYLSAKQLK AGEDPYRQHA FNQLESDKLS
    110 120 130 140 150
    PDRPIRDTRH YSCPSVSYSS DLPATSVIIT FHNEARSTLL RTVKSVLNRT
    160 170 180 190 200
    PANLIQEIIL VDDFSSDPED CLLLTRIPKV KCLRNDRREG LIRSRVRGAD
    210 220 230 240 250
    VAAATVLTFL DSHCEVNTEW LPPMLQRVKE DHTRVVSPII DVISLDNFAY
    260 270 280 290 300
    LAASADLRGG FDWSLHFKWE QIPLEQKMTR TDPTRPIRTP VIAGGIFVID
    310 320 330 340 350
    KSWFNHLGKY DAQMDIWGGE NFELSFRVWM CGGSLEIVPC SRVGHVFRKR
    360 370 380 390 400
    HPYNFPEGNA LTYIRNTKRT AEVWMDEYKQ YYYEARPSAI GKAFGSVATR
    410 420 430 440 450
    IEQRKKMNCK SFRWYLENVY PELTVPVKEA LPGIIKQGVN CLESQGQNTA
    460 470 480 490 500
    GDFLLGMGIC RGSAKNPQPA QAWLFSDHLI QQQGKCLAAT STLMSSPGSP
    510 520 530 540 550
    VILQMCNPRE GKQKWRRKGS FIQHSVSGLC LETKPAQLVT SKCQADAQAQ

    QWQLLPHT
    Length:558
    Mass (Da):63,074
    Last modified:August 16, 2004 - v2
    Checksum:iFF35C5606B5291B8
    GO
    Isoform 2 (identifier: Q8N428-2) [UniParc]FASTAAdd to basket

    The sequence of this isoform differs from the canonical sequence as follows:
         514-558: KWRRKGSFIQHSVSGLCLETKPAQLVTSKCQADAQAQQWQLLPHT → VSLLASGPEAQQPEGPCLRVADLGRRAPD

    Show »
    Length:542
    Mass (Da):60,972
    Checksum:i1E517B517B2568A9
    GO

    Sequence cautioni

    The sequence BAA86444 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

    Natural variant

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    Natural variantiVAR_055848201V → M2 PublicationsCorresponds to variant dbSNP:rs12879377Ensembl.1
    Natural variantiVAR_061195497P → S. Corresponds to variant dbSNP:rs59840366Ensembl.1

    Alternative sequence

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    Alternative sequenceiVSP_011231514 – 558KWRRK…LLPHT → VSLLASGPEAQQPEGPCLRV ADLGRRAPD in isoform 2. 2 PublicationsAdd BLAST45

    Sequence databases

    Select the link destinations:
    EMBLi
    GenBanki
    DDBJi
    Links Updated
    AB032956 mRNA Translation: BAA86444.1 Different initiation.
    AB078143 mRNA Translation: BAD93178.1
    AK289745 mRNA Translation: BAF82434.1
    CH471061 Genomic DNA Translation: EAW80987.1
    BC036812 mRNA Translation: AAH36812.2
    BC098578 mRNA Translation: AAH98578.1
    CCDSiCCDS32107.1 [Q8N428-1]
    RefSeqiNP_001161840.1, NM_001168368.1 [Q8N428-1]
    NP_065743.2, NM_020692.2 [Q8N428-1]
    XP_011535307.1, XM_011537005.1 [Q8N428-1]
    XP_011535308.1, XM_011537006.2 [Q8N428-1]
    XP_016876987.1, XM_017021498.1 [Q8N428-1]
    UniGeneiHs.21035

    Genome annotation databases

    EnsembliENST00000337827; ENSP00000336729; ENSG00000100626 [Q8N428-1]
    ENST00000448469; ENSP00000402970; ENSG00000100626 [Q8N428-1]
    ENST00000553471; ENSP00000451420; ENSG00000100626 [Q8N428-2]
    ENST00000553669; ENSP00000451200; ENSG00000100626 [Q8N428-2]
    GeneIDi57452
    KEGGihsa:57452
    UCSCiuc001xla.3 human [Q8N428-1]

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Similar proteinsi

    Entry informationi

    Entry nameiGLT16_HUMAN
    AccessioniPrimary (citable) accession number: Q8N428
    Secondary accession number(s): Q4KMG3, Q58A55, Q9ULT9
    Entry historyiIntegrated into UniProtKB/Swiss-Prot: August 16, 2004
    Last sequence update: August 16, 2004
    Last modified: May 23, 2018
    This is version 136 of the entry and version 2 of the sequence. See complete history.
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 14
      Human chromosome 14: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. PATHWAY comments
      Index of metabolic and biosynthesis pathways
    6. SIMILARITY comments
      Index of protein domains and families

    Cookie policy

    We would like to use anonymized google analytics cookies to gather statistics on how uniprot.org is used in aggregate. Learn more

    UniProt is an ELIXIR core data resource
    Main funding by: National Institutes of Health