Q8N428 (GLTL1_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 85.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Putative polypeptide N-acetylgalactosaminyltransferase-like protein 1 EC=2.4.1.41 Alternative name(s): Polypeptide GalNAc transferase-like protein 1 Short name=GalNAc-T-like protein 1 Short name=pp-GaNTase-like protein 1 Protein-UDP acetylgalactosaminyltransferase-like protein 1 UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase-like protein 1 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 558 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Function | May catalyze the initial reaction in O-linked oligosaccharide biosynthesis, the transfer of an N-acetyl-D-galactosamine residue to a serine or threonine residue on the protein receptor By similarity. |
| Catalytic activity | UDP-N-acetyl-D-galactosamine + polypeptide = UDP + N-acetyl-D-galactosaminyl-polypeptide. |
| Cofactor | Manganese By similarity. Calcium By similarity. |
| Pathway | |
| Subcellular location | Golgi apparatus membrane; Single-pass type II membrane protein By similarity. |
| Domain | There are two conserved domains in the glycosyltransferase region: the N-terminal domain (domain A, also called GT1 motif), which is probably involved in manganese coordination and substrate binding and the C-terminal domain (domain B, also called Gal/GalNAc-T motif), which is probably involved in catalytic reaction and UDP-Gal binding By similarity. The ricin B-type lectin domain binds to GalNAc and contributes to the glycopeptide specificity By similarity. |
| Sequence similarities | Belongs to the glycosyltransferase 2 family. GalNAc-T subfamily. Contains 1 ricin B-type lectin domain. |
| Sequence caution | The sequence BAA86444.1 differs from that shown. Reason: Erroneous initiation. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Golgi apparatus Membrane |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Signal-anchor Transmembrane Transmembrane helix |
| Ligand | Calcium Lectin Manganese |
| Molecular function | Glycosyltransferase Transferase |
| PTM | Disulfide bond |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Cellular component | Golgi membrane Inferred from electronic annotation. Source: UniProtKB-SubCell integral to membraneInferred from electronic annotation. Source: UniProtKB-KW |
| Molecular function | polypeptide N-acetylgalactosaminyltransferase activity Inferred from electronic annotation. Source: EC sugar bindingInferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q8N428-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q8N428-2) The sequence of this isoform differs from the canonical sequence as follows: 514-558: KWRRKGSFIQHSVSGLCLETKPAQLVTSKCQADAQAQQWQLLPHT → VSLLASGPEAQQPEGPCLRVADLGRRAPD | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 558 | 558 | Putative polypeptide N-acetylgalactosaminyltransferase-like protein 1 | PRO_0000059135 | |||||||
Regions | |||||||||||
| Topological domain | 1 – 6 | 6 | Cytoplasmic Potential | ||||||||
| Transmembrane | 7 – 26 | 20 | Helical; Signal-anchor for type II membrane protein; Potential | ||||||||
| Topological domain | 27 – 558 | 532 | Lumenal Potential | ||||||||
| Domain | 428 – 555 | 128 | Ricin B-type lectin | ||||||||
| Region | 122 – 227 | 106 | Catalytic subdomain A | ||||||||
| Region | 286 – 348 | 63 | Catalytic subdomain B | ||||||||
Amino acid modifications | |||||||||||
| Disulfide bond | 441 ↔ 460 | By similarity | |||||||||
| Disulfide bond | 486 ↔ 506 | By similarity | |||||||||
| Disulfide bond | 530 ↔ 543 | By similarity | |||||||||
Natural variations | |||||||||||
| Alternative sequence | 514 – 558 | 45 | KWRRK…LLPHT → VSLLASGPEAQQPEGPCLRV ADLGRRAPD in isoform 2. | VSP_011231 | |||||||
| Natural variant | 201 | 1 | V → M. Ref.2 Ref.3 Corresponds to variant rs12879377 [ dbSNP | Ensembl ]. | VAR_055848 | |||||||
| Natural variant | 497 | 1 | P → S. Corresponds to variant rs59840366 [ dbSNP | Ensembl ]. | VAR_061195 | |||||||
Sequences
| ||||||||||||||||||||||||
References
| [1] | "Characterization of cDNA clones selected by the GeneMark analysis from size-fractionated cDNA libraries from human brain." Hirosawa M., Nagase T., Ishikawa K., Kikuno R., Nomura N., Ohara O. DNA Res. 6:329-336(1999) [PubMed: 10574461] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Brain. |
| [2] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT MET-201. Tissue: Brain. |
| [3] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT MET-201. Tissue: Brain and Chondrosarcoma. |
| + | Additional computationally mapped references. |
Web resources
| GGDB GlycoGene database |
| Functional Glycomics Gateway - GTase Putative polypeptide N-acetylgalactosaminyltransferase-like protein 1 |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AB032956 mRNA. Translation: BAA86444.1. Different initiation. AK289745 mRNA. Translation: BAF82434.1. BC036812 mRNA. Translation: AAH36812.2. BC098578 mRNA. Translation: AAH98578.1. |
| IPI | IPI00166613. IPI00456715. |
| RefSeq | NP_001161840.1. NM_001168368.1. NP_065743.2. NM_020692.2. |
| UniGene | Hs.21035. |
3D structure databases | |
| ProteinModelPortal | Q8N428. |
| SMR | Q8N428. Positions 65-556. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | Q8N428. |
Protein family/group databases | |
| CAZy | CBM13. Carbohydrate-Binding Module Family 13. GT27. Glycosyltransferase Family 27. |
Polymorphism databases | |
| DMDM | 51316024. |
Proteomic databases | |
| PRIDE | Q8N428. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000337827; ENSP00000336729; ENSG00000100626. |
| GeneID | 57452. |
| KEGG | hsa:57452. |
| UCSC | uc001xla.1. human. uc010aqu.1. human. |
Organism-specific databases | |
| CTD | 57452. |
| GeneCards | GC14P069726. |
| HGNC | HGNC:23233. GALNTL1. |
| neXtProt | NX_Q8N428. |
| HUGE | Search... |
| GenAtlas | Search... |
Phylogenomic databases | |
| GeneTree | ENSGT00560000076578. |
| HOGENOM | HBG715048. |
| HOVERGEN | HBG051699. |
| InParanoid | Q8N428. |
| OMA | PTKPIRT. |
| OrthoDB | EOG4DZ1V4. |
| PhylomeDB | Q8N428. |
Gene expression databases | |
| ArrayExpress | Q8N428. |
| Bgee | Q8N428. |
| CleanEx | HS_GALNTL1. |
| Genevestigator | Q8N428. |
| GermOnline | ENSG00000100626. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR001173. Glyco_trans_2. IPR008997. Ricin_B-rel_lectin. IPR000772. Ricin_B_lectin. [Graphical view] |
| KO | K00710. |
| Pfam | PF00535. Glycos_transf_2. 1 hit. PF00652. Ricin_B_lectin. 1 hit. [Graphical view] |
| SMART | SM00458. RICIN. 1 hit. [Graphical view] |
| SUPFAM | SSF50370. RicinB_like. 1 hit. |
| PROSITE | PS50231. RICIN_B_LECTIN. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Entry information
| Entry name | GLTL1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q8N428 Secondary accession number(s): Q4KMG3, Q9ULT9 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 14 Human chromosome 14: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| PATHWAY comments Index of metabolic and biosynthesis pathways |
| SIMILARITY comments Index of protein domains and families |

Clusters with