Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q8N428 (GLT16_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 107. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (5) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Polypeptide N-acetylgalactosaminyltransferase 16

EC=2.4.1.41
Alternative name(s):
Polypeptide GalNAc transferase 16
Short name=GalNAc-T16
Polypeptide GalNAc transferase-like protein 1
Short name=GalNAc-T-like protein 1
Short name=pp-GaNTase-like protein 1
Polypeptide N-acetylgalactosaminyltransferase-like protein 1
Protein-UDP acetylgalactosaminyltransferase-like protein 1
UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase-like protein 1
Gene names
Name:GALNT16
Synonyms:GALNTL1, KIAA1130
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length558 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Catalyzes the initial reaction in O-linked oligosaccharide biosynthesis, the transfer of an N-acetyl-D-galactosamine residue to a serine or threonine residue on the protein receptor. Ref.6

Catalytic activity

UDP-N-acetyl-alpha-D-galactosamine + polypeptide = UDP + N-acetyl-alpha-D-galactosaminyl-polypeptide. Ref.6

Cofactor

Manganese By similarity.

Pathway

Protein modification; protein glycosylation.

Subcellular location

Golgi apparatus membrane; Single-pass type II membrane protein By similarity.

Domain

There are two conserved domains in the glycosyltransferase region: the N-terminal domain (domain A, also called GT1 motif), which is probably involved in manganese coordination and substrate binding and the C-terminal domain (domain B, also called Gal/GalNAc-T motif), which is probably involved in catalytic reaction and UDP-Gal binding By similarity.

The ricin B-type lectin domain binds to GalNAc and contributes to the glycopeptide specificity By similarity.

Sequence similarities

Belongs to the glycosyltransferase 2 family. GalNAc-T subfamily.

Contains 1 ricin B-type lectin domain.

Biophysicochemical properties

Kinetic parameters:

KM=251 µM for Muc5AC Ref.6

KM=310 µM for Muc5AC-3

KM=390 µM for Muc5AC-13

KM=332 µM for EA2

Sequence caution

The sequence BAA86444.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.

Ontologies

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q8N428-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q8N428-2)

The sequence of this isoform differs from the canonical sequence as follows:
     514-558: KWRRKGSFIQHSVSGLCLETKPAQLVTSKCQADAQAQQWQLLPHT → VSLLASGPEAQQPEGPCLRVADLGRRAPD

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 558558Polypeptide N-acetylgalactosaminyltransferase 16
PRO_0000059135

Regions

Topological domain1 – 66Cytoplasmic Potential
Transmembrane7 – 2620Helical; Signal-anchor for type II membrane protein; Potential
Topological domain27 – 558532Lumenal Potential
Domain428 – 555128Ricin B-type lectin
Region122 – 227106Catalytic subdomain A
Region286 – 34863Catalytic subdomain B

Sites

Metal binding2111Manganese By similarity
Metal binding2131Manganese By similarity
Metal binding3451Manganese By similarity
Binding site1631Substrate By similarity
Binding site1881Substrate By similarity
Binding site2121Substrate By similarity
Binding site3171Substrate By similarity
Binding site3481Substrate By similarity
Binding site3511Substrate By similarity
Binding site3531Substrate By similarity

Amino acid modifications

Disulfide bond113 ↔ 340 By similarity
Disulfide bond331 ↔ 409 By similarity
Disulfide bond441 ↔ 460 By similarity
Disulfide bond486 ↔ 506 By similarity
Disulfide bond530 ↔ 543 By similarity

Natural variations

Alternative sequence514 – 55845KWRRK…LLPHT → VSLLASGPEAQQPEGPCLRV ADLGRRAPD in isoform 2.
VSP_011231
Natural variant2011V → M. Ref.3 Ref.5
Corresponds to variant rs12879377 [ dbSNP | Ensembl ].
VAR_055848
Natural variant4971P → S.
Corresponds to variant rs59840366 [ dbSNP | Ensembl ].
VAR_061195

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified August 16, 2004. Version 2.
Checksum: FF35C5606B5291B8

FASTA55863,074
        10         20         30         40         50         60 
MRKIRANAIA ILTVAWILGT FYYLWQDNRA HAASSGGRGA QRAGRRSEQL REDRTIPLIV 

        70         80         90        100        110        120 
TGTPSKGFDE KAYLSAKQLK AGEDPYRQHA FNQLESDKLS PDRPIRDTRH YSCPSVSYSS 

       130        140        150        160        170        180 
DLPATSVIIT FHNEARSTLL RTVKSVLNRT PANLIQEIIL VDDFSSDPED CLLLTRIPKV 

       190        200        210        220        230        240 
KCLRNDRREG LIRSRVRGAD VAAATVLTFL DSHCEVNTEW LPPMLQRVKE DHTRVVSPII 

       250        260        270        280        290        300 
DVISLDNFAY LAASADLRGG FDWSLHFKWE QIPLEQKMTR TDPTRPIRTP VIAGGIFVID 

       310        320        330        340        350        360 
KSWFNHLGKY DAQMDIWGGE NFELSFRVWM CGGSLEIVPC SRVGHVFRKR HPYNFPEGNA 

       370        380        390        400        410        420 
LTYIRNTKRT AEVWMDEYKQ YYYEARPSAI GKAFGSVATR IEQRKKMNCK SFRWYLENVY 

       430        440        450        460        470        480 
PELTVPVKEA LPGIIKQGVN CLESQGQNTA GDFLLGMGIC RGSAKNPQPA QAWLFSDHLI 

       490        500        510        520        530        540 
QQQGKCLAAT STLMSSPGSP VILQMCNPRE GKQKWRRKGS FIQHSVSGLC LETKPAQLVT 

       550 
SKCQADAQAQ QWQLLPHT 

« Hide

Isoform 2 [UniParc].

Checksum: 1E517B517B2568A9
Show »

FASTA54260,972

References

« Hide 'large scale' references
[1]"Characterization of cDNA clones selected by the GeneMark analysis from size-fractionated cDNA libraries from human brain."
Hirosawa M., Nagase T., Ishikawa K., Kikuno R., Nomura N., Ohara O.
DNA Res. 6:329-336(1999) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
Tissue: Brain.
[2]"Cloning and Characterization of New Member of Human UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase, Designated GalNAc-T16."
Guo J., Zhang Y., Chen L., Narimatsu H.
Submitted (JAN-2002) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
Tissue: Fetal brain.
[3]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT MET-201.
Tissue: Brain.
[4]Mural R.J., Istrail S., Sutton G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[5]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT MET-201.
Tissue: Brain and Chondrosarcoma.
[6]"UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferases: completion of the family tree."
Raman J., Guan Y., Perrine C.L., Gerken T.A., Tabak L.A.
Glycobiology 22:768-777(2012) [PubMed] [Europe PMC] [Abstract]
Cited for: FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES.
+Additional computationally mapped references.

Web resources

GGDB

GlycoGene database

Functional Glycomics Gateway - GTase

Putative polypeptide N-acetylgalactosaminyltransferase-like protein 1

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AB032956 mRNA. Translation: BAA86444.1. Different initiation.
AB078143 mRNA. Translation: BAD93178.1.
AK289745 mRNA. Translation: BAF82434.1.
CH471061 Genomic DNA. Translation: EAW80987.1.
BC036812 mRNA. Translation: AAH36812.2.
BC098578 mRNA. Translation: AAH98578.1.
RefSeqNP_001161840.1. NM_001168368.1.
NP_065743.2. NM_020692.2.
UniGeneHs.21035.

3D structure databases

ProteinModelPortalQ8N428.
SMRQ8N428. Positions 90-554.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

STRING9606.ENSP00000336729.

Protein family/group databases

CAZyCBM13. Carbohydrate-Binding Module Family 13.
GT27. Glycosyltransferase Family 27.

PTM databases

PhosphoSiteQ8N428.

Polymorphism databases

DMDM51316024.

Proteomic databases

PaxDbQ8N428.
PRIDEQ8N428.

Protocols and materials databases

DNASU57452.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000337827; ENSP00000336729; ENSG00000100626. [Q8N428-1]
ENST00000448469; ENSP00000402970; ENSG00000100626. [Q8N428-1]
ENST00000553471; ENSP00000451420; ENSG00000100626. [Q8N428-2]
ENST00000553669; ENSP00000451200; ENSG00000100626. [Q8N428-2]
GeneID57452.
KEGGhsa:57452.
UCSCuc001xlb.2. human. [Q8N428-1]

Organism-specific databases

CTD57452.
GeneCardsGC14P069725.
HGNCHGNC:23233. GALNT16.
HPAHPA059136.
neXtProtNX_Q8N428.
PharmGKBPA134991608.
HUGESearch...
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG239675.
HOGENOMHOG000038227.
HOVERGENHBG051699.
InParanoidQ8N428.
KOK00710.
OMAPEDCQLL.
OrthoDBEOG7J9VP2.
PhylomeDBQ8N428.
TreeFamTF313267.

Enzyme and pathway databases

ReactomeREACT_17015. Metabolism of proteins.
UniPathwayUPA00378.

Gene expression databases

ArrayExpressQ8N428.
BgeeQ8N428.
CleanExHS_GALNTL1.
GenevestigatorQ8N428.

Family and domain databases

InterProIPR027791. Galactosyl_T_C.
IPR001173. Glyco_trans_2-like.
IPR000772. Ricin_B_lectin.
[Graphical view]
PfamPF02709. Glyco_transf_7C. 1 hit.
PF00535. Glycos_transf_2. 1 hit.
PF00652. Ricin_B_lectin. 1 hit.
[Graphical view]
SMARTSM00458. RICIN. 1 hit.
[Graphical view]
SUPFAMSSF50370. SSF50370. 1 hit.
PROSITEPS50231. RICIN_B_LECTIN. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

GenomeRNAi57452.
NextBio63624.
PROQ8N428.

Entry information

Entry nameGLT16_HUMAN
AccessionPrimary (citable) accession number: Q8N428
Secondary accession number(s): Q4KMG3, Q58A55, Q9ULT9
Entry history
Integrated into UniProtKB/Swiss-Prot: August 16, 2004
Last sequence update: August 16, 2004
Last modified: April 16, 2014
This is version 107 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

PATHWAY comments

Index of metabolic and biosynthesis pathways

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 14

Human chromosome 14: entries, gene names and cross-references to MIM