Q8N3U4 (STAG2_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 97.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Cohesin subunit SA-2 Alternative name(s): SCC3 homolog 2 Stromal antigen 2 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 1231 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Component of cohesin complex, a complex required for the cohesion of sister chromatids after DNA replication. The cohesin complex apparently forms a large proteinaceous ring within which sister chromatids can be trapped. At anaphase, the complex is cleaved and dissociates from chromatin, allowing sister chromatids to segregate. The cohesin complex may also play a role in spindle pole assembly during mitosis. Ref.8 |
| Subunit structure | Interacts directly with RAD21 in cohesin complex. Cohesin complexes are composed of a heterodimer between a SMC1 protein (SMC1A or SMC1B) and SMC3, which are attached via their hinge domain, and RAD21 which link them at their heads, and one STAG protein (STAG1, STAG2 or STAG3). In cohesin complexes, STAG2 is mutually exclusive with STAG1 and STAG3. |
| Subcellular location | Nucleus. Chromosome. Chromosome › centromere. Note: Associates with chromatin. Before prophase it is scattered along chromosome arms. During prophase, most of cohesin complexes dissociate from chromatin probably because of phosphorylation by PLK1, except at centromeres, where cohesin complexes remain. At anaphase, the RAD21 subunit of cohesin is cleaved, leading to the dissociation of the complex from chromosomes, allowing chromosome separation. In germ cells, cohesin complex dissociates from chromatin at prophase I, and may be replaced by a meiosis-specific cohesin complex. |
| Post-translational modification | Phosphorylated by PLK1. The large dissociation of cohesin from chromosome arms during prophase is partly due to its phosphorylation By similarity. Ref.9 Ref.10 Ref.11 Ref.12 |
| Sequence similarities | Belongs to the SCC3 family. Contains 1 SCD (stromalin conservative) domain. |
| Sequence caution | The sequence CAA99732.1 differs from that shown. Reason: Erroneous initiation. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| PDS5A | Q29RF7 | 3 | EBI-1057252,EBI-1175454 | |
| PDS5B | Q9NTI5 | 3 | EBI-1057252,EBI-1175604 | |
| SMC3 | Q9UQE7 | 6 | EBI-1057252,EBI-80718 |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q8N3U4-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q8N3U4-2) The sequence of this isoform differs from the canonical sequence as follows: 1156-1156: N → NTQVTWMLAQRQQEEARQQQERAAMSYVKLRTNLQHAI |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1231 | 1231 | Cohesin subunit SA-2 | PRO_0000120185 | |||||
Regions | |||||||||
| Domain | 293 – 378 | 86 | SCD | ||||||
| Compositional bias | 1096 – 1101 | 6 | Poly-Ser | ||||||
Amino acid modifications | |||||||||
| Modified residue | 607 | 1 | N6-acetyllysine Ref.13 | ||||||
| Modified residue | 1058 | 1 | Phosphoserine Ref.11 Ref.12 | ||||||
| Modified residue | 1061 | 1 | Phosphoserine Ref.9 Ref.10 Ref.11 Ref.12 | ||||||
| Modified residue | 1065 | 1 | Phosphoserine Ref.11 | ||||||
| Modified residue | 1112 | 1 | Phosphothreonine Ref.12 | ||||||
| Modified residue | 1160 | 1 | Phosphothreonine By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 1156 | 1 | N → NTQVTWMLAQRQQEEARQQQ ERAAMSYVKLRTNLQHAI in isoform 2. | VSP_041119 | |||||
| Natural variant | 699 | 1 | N → K. Corresponds to variant rs6655782 [ dbSNP | Ensembl ]. | VAR_060114 | |||||
Experimental info | |||||||||
| Sequence conflict | 46 | 1 | G → D in CAD38591. Ref.1 | ||||||
| Sequence conflict | 302 | 1 | A → R in CAA99732. Ref.5 | ||||||
| Sequence conflict | 327 | 1 | S → G in CAD38591. Ref.1 | ||||||
| Sequence conflict | 607 – 608 | 2 | KH → ND in CAA99732. Ref.5 | ||||||
| Sequence conflict | 706 | 1 | W → R in CAA99732. Ref.5 | ||||||
| Sequence conflict | 710 | 1 | A → V in CAD38591. Ref.1 | ||||||
| Sequence conflict | 835 | 1 | I → T in CAD38591. Ref.1 | ||||||
| Sequence conflict | 971 | 1 | A → T in CAH18271. Ref.1 | ||||||
| Sequence conflict | 992 | 1 | H → Y in CAD38591. Ref.1 | ||||||
| Sequence conflict | 1105 | 1 | S → T in CAA99732. Ref.5 | ||||||
| Sequence conflict | 1144 | 1 | M → K in CAA99732. Ref.5 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "The full-ORF clone resource of the German cDNA consortium." Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I. BMC Genomics 8:399-399(2007) [PubMed: 17974005] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2). Tissue: Retina and Spinal cord. |
| [2] | "The DNA sequence of the human X chromosome." Ross M.T., Grafham D.V., Coffey A.J., Scherer S., McLay K., Muzny D., Platzer M., Howell G.R., Burrows C., Bird C.P., Frankish A., Lovell F.L., Howe K.L., Ashurst J.L., Fulton R.S., Sudbrak R., Wen G., Jones M.C. Bentley D.R.Nature 434:325-337(2005) [PubMed: 15772651] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [3] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Eye. |
| [5] | "SA-1, a nuclear protein encoded by one member of a novel gene family: molecular cloning and detection in hemopoietic organs." Carramolino L., Lee B.C., Zaballos A., Peled A., Barthelemy I., Shav-Tal Y., Prieto I., Carmi P., Gothelf Y., Gonzalez de Buitrago G., Aracil M., Marquez G., Barbero J.L., Zipori D. Gene 195:151-159(1997) [PubMed: 9305759] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 48-1231 (ISOFORM 1). Tissue: Thymus. |
| [6] | Erratum Carramolino L., Lee B.C., Zaballos A., Peled A., Barthelemy I., Shav-Tal Y., Prieto I., Carmi P., Gothelf Y., Gonzalez de Buitrago G., Aracil M., Marquez G., Barbero J.L., Zipori D. Gene 206:283-286(1998) |
| [7] | "Characterization of vertebrate cohesin complexes and their regulation in prophase." Sumara I., Vorlaufer E., Gieffers C., Peters B.H., Peters J.-M. J. Cell Biol. 151:749-762(2000) [PubMed: 11076961] [Abstract] Cited for: IDENTIFICATION IN A COHESIN COMPLEX WITH SMC1A AND SMC3. |
| [8] | "STAG2 and Rad21 mammalian mitotic cohesins are implicated in meiosis." Prieto I., Pezzi N., Buesa J.M., Kremer L., Barthelemy I., Carreiro C., Roncal F., Martinez A., Gomez L., Fernandez R., Martinez-A C., Barbero J.L. EMBO Rep. 3:543-550(2002) [PubMed: 12034751] [Abstract] Cited for: FUNCTION IN EARLY STEPS OF MEIOSIS. |
| [9] | "Large-scale characterization of HeLa cell nuclear phosphoproteins." Beausoleil S.A., Jedrychowski M., Schwartz D., Elias J.E., Villen J., Li J., Cohn M.A., Cantley L.C., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 101:12130-12135(2004) [PubMed: 15302935] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1061, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [10] | "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks." Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M. Cell 127:635-648(2006) [PubMed: 17081983] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1061, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [11] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed: 18669648] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1058; SER-1061 AND SER-1065, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [12] | "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions." Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K. Sci. Signal. 2:RA46-RA46(2009) [PubMed: 19690332] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1058; SER-1061 AND THR-1112, MASS SPECTROMETRY. Tissue: Leukemic T-cell. |
| [13] | "Lysine acetylation targets protein complexes and co-regulates major cellular functions." Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T., Olsen J.V., Mann M. Science 325:834-840(2009) [PubMed: 19608861] [Abstract] Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-607, MASS SPECTROMETRY. |
| [14] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed: 21269460] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AL831939 mRNA. Translation: CAD38591.1. CR749433 mRNA. Translation: CAH18271.1. AL355476 Genomic DNA. Translation: CAI40990.1. AL355476 Genomic DNA. Translation: CAI40991.1. CH471107 Genomic DNA. Translation: EAX11853.1. CH471107 Genomic DNA. Translation: EAX11854.1. CH471107 Genomic DNA. Translation: EAX11855.1. CH471107 Genomic DNA. Translation: EAX11856.1. CH471107 Genomic DNA. Translation: EAX11857.1. BC001765 mRNA. Translation: AAH01765.2. Z75331 mRNA. Translation: CAA99732.1. Different initiation. |
| IPI | IPI00470883. IPI00552978. |
| RefSeq | NP_001036214.1. NM_001042749.1. NP_001036215.1. NM_001042750.1. NP_001036216.1. NM_001042751.1. NP_006594.3. NM_006603.4. |
| UniGene | Hs.496710. Hs.624663. |
3D structure databases | |
| ProteinModelPortal | Q8N3U4. |
| ModBase | Search... |
Protein-protein interaction databases | |
| DIP | DIP-35418N. |
| IntAct | Q8N3U4. 11 interactions. |
| MINT | MINT-6178117. |
| STRING | Q8N3U4. |
PTM databases | |
| PhosphoSite | Q8N3U4. |
Polymorphism databases | |
| DMDM | 73621291. |
Proteomic databases | |
| PRIDE | Q8N3U4. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000371144; ENSP00000360186; ENSG00000101972. ENST00000371157; ENSP00000360199; ENSG00000101972. ENST00000371160; ENSP00000360202; ENSG00000101972. |
| GeneID | 10735. |
| KEGG | hsa:10735. |
| UCSC | uc004etz.2. human. |
Organism-specific databases | |
| CTD | 10735. |
| GeneCards | GC0XP123094. |
| H-InvDB | HIX0017034. |
| HGNC | HGNC:11355. STAG2. |
| HPA | HPA002857. |
| MIM | 300826. gene. |
| neXtProt | NX_Q8N3U4. |
| PharmGKB | PA36177. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | prNOG11650. |
| GeneTree | ENSGT00390000014094. |
| HOVERGEN | HBG057636. |
| PhylomeDB | Q8N3U4. |
Enzyme and pathway databases | |
| Reactome | REACT_111183. Meiosis. REACT_152. Cell Cycle, Mitotic. REACT_383. DNA Replication. |
Gene expression databases | |
| ArrayExpress | Q8N3U4. |
| Bgee | Q8N3U4. |
| CleanEx | HS_STAG2. |
| Genevestigator | Q8N3U4. |
| GermOnline | ENSG00000101972. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR011989. ARM-like. IPR016024. ARM-type_fold. IPR020839. SCD. IPR013721. STAG. [Graphical view] |
| Gene3D | G3DSA:1.25.10.10. ARM-like. 5 hits. |
| KO | K06671. |
| Pfam | PF08514. STAG. 1 hit. [Graphical view] |
| SUPFAM | SSF48371. ARM-type_fold. 1 hit. |
| PROSITE | PS51425. SCD. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 40752. |
| SOURCE | Search... |
Entry information
| Entry name | STAG2_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q8N3U4 Secondary accession number(s): B1AMT5 Q9H1N8 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome X Human chromosome X: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with