Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q8N3F0 (MTURN_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 73. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (2) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Maturin
Alternative name(s):
Maturin neural progenitor differentiation regulator protein homolog
Protein Ells1
Gene names
Name:MTURN
Synonyms:C7orf41
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length131 AA.
Sequence statusComplete.
Protein existenceEvidence at transcript level

General annotation (Comments)

Function

May be involved in early neuronal development By similarity.

Sequence similarities

Belongs to the MTURN family.

Ontologies

Keywords
   Coding sequence diversityAlternative splicing
   Molecular functionDevelopmental protein
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Biological_processmulticellular organismal development

Inferred from electronic annotation. Source: UniProtKB-KW

Complete GO annotation...

Alternative products

This entry describes 4 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q8N3F0-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q8N3F0-2)

The sequence of this isoform differs from the canonical sequence as follows:
     95-131: PLLGLPDADDDAFEEYSADVEEEEPEADHPQMGVSQQ → GLISAVHALPVETWLFFVLWQTGALEVVYV
Note: No experimental confirmation available.
Isoform 3 (identifier: Q8N3F0-3)

The sequence of this isoform differs from the canonical sequence as follows:
     1-54: MDFQQLADVAEKWCSNTPFELIATEETERRMDFYADPGVSFYVLCPDNGCGDNF → MATHCPLYCVGADLMMNRAGE
Note: No experimental confirmation available.
Isoform 4 (identifier: Q8N3F0-4)

The sequence of this isoform differs from the canonical sequence as follows:
     55-95: Missing.
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 131131Maturin
PRO_0000294233

Regions

Compositional bias115 – 1206Poly-Glu

Natural variations

Alternative sequence1 – 5454MDFQQ…CGDNF → MATHCPLYCVGADLMMNRAG E in isoform 3.
VSP_026608
Alternative sequence55 – 9541Missing in isoform 4.
VSP_053525
Alternative sequence95 – 13137PLLGL…GVSQQ → GLISAVHALPVETWLFFVLW QTGALEVVYV in isoform 2.
VSP_026609

Experimental info

Sequence conflict821L → P in BAC04811. Ref.2

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified September 13, 2004. Version 2.
Checksum: BD60297F085B5C59

FASTA13114,925
        10         20         30         40         50         60 
MDFQQLADVA EKWCSNTPFE LIATEETERR MDFYADPGVS FYVLCPDNGC GDNFHVWSES 

        70         80         90        100        110        120 
EDCLPFLQLA QDYISSCGKK TLHEVLEKVF KSFRPLLGLP DADDDAFEEY SADVEEEEPE 

       130 
ADHPQMGVSQ Q 

« Hide

Isoform 2 [UniParc].

Checksum: 3B6E4F858C4ADE6B
Show »

FASTA12414,210
Isoform 3 [UniParc].

Checksum: 57FD332B2474E7E1
Show »

FASTA9811,021
Isoform 4 [UniParc].

Checksum: CC401B373E028696
Show »

FASTA9010,147

References

« Hide 'large scale' references
[1]"A high-resolution 5.0-Megabase transcript map of the CMT2D region on human chromosome 7."
Ellsworth R.E., Lee Lin S.-Q., Green E.D.
Submitted (AUG-2001) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3).
[2]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
Tissue: Brain.
[3]"The full-ORF clone resource of the German cDNA consortium."
Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I.
BMC Genomics 8:399-399(2007) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Amygdala.
[4]"The DNA sequence of human chromosome 7."
Hillier L.W., Fulton R.S., Fulton L.A., Graves T.A., Pepin K.H., Wagner-McPherson C., Layman D., Maas J., Jaeger S., Walker R., Wylie K., Sekhon M., Becker M.C., O'Laughlin M.D., Schaller M.E., Fewell G.A., Delehaunty K.D., Miner T.L. expand/collapse author list , Nash W.E., Cordes M., Du H., Sun H., Edwards J., Bradshaw-Cordum H., Ali J., Andrews S., Isak A., Vanbrunt A., Nguyen C., Du F., Lamar B., Courtney L., Kalicki J., Ozersky P., Bielicki L., Scott K., Holmes A., Harkins R., Harris A., Strong C.M., Hou S., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Leonard S., Rohlfing T., Rock S.M., Tin-Wollam A.-M., Abbott A., Minx P., Maupin R., Strowmatt C., Latreille P., Miller N., Johnson D., Murray J., Woessner J.P., Wendl M.C., Yang S.-P., Schultz B.R., Wallis J.W., Spieth J., Bieri T.A., Nelson J.O., Berkowicz N., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Bedell J.A., Mardis E.R., Clifton S.W., Chissoe S.L., Marra M.A., Raymond C., Haugen E., Gillett W., Zhou Y., James R., Phelps K., Iadanoto S., Bubb K., Simms E., Levy R., Clendenning J., Kaul R., Kent W.J., Furey T.S., Baertsch R.A., Brent M.R., Keibler E., Flicek P., Bork P., Suyama M., Bailey J.A., Portnoy M.E., Torrents D., Chinwalla A.T., Gish W.R., Eddy S.R., McPherson J.D., Olson M.V., Eichler E.E., Green E.D., Waterston R.H., Wilson R.K.
Nature 424:157-164(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AY054121 mRNA. Translation: AAL14866.1.
AK096533 mRNA. Translation: BAC04811.1.
AK098769 mRNA. Translation: BAC05408.1.
AL834391 mRNA. Translation: CAD39053.2.
AC007036 Genomic DNA. No translation available.
CCDSCCDS5425.2. [Q8N3F0-1]
RefSeqNP_690006.2. NM_152793.2. [Q8N3F0-1]
XP_005249709.1. XM_005249652.1. [Q8N3F0-1]
UniGeneHs.200100.

3D structure databases

ProteinModelPortalQ8N3F0.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid128785. 4 interactions.

PTM databases

PhosphoSiteQ8N3F0.

Polymorphism databases

DMDM74714835.

Proteomic databases

MaxQBQ8N3F0.
PaxDbQ8N3F0.
PRIDEQ8N3F0.

Protocols and materials databases

DNASU222166.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000324453; ENSP00000324204; ENSG00000180354. [Q8N3F0-1]
ENST00000324489; ENSP00000324755; ENSG00000180354. [Q8N3F0-3]
ENST00000409688; ENSP00000386490; ENSG00000180354. [Q8N3F0-4]
ENST00000415604; ENSP00000387585; ENSG00000180354. [Q8N3F0-1]
ENST00000455738; ENSP00000389035; ENSG00000180354. [Q8N3F0-3]
GeneID222166.
KEGGhsa:222166.
UCSCuc003tar.1. human. [Q8N3F0-1]

Organism-specific databases

CTD222166.
GeneCardsGC07P030141.
H-InvDBHIX0006564.
HGNCHGNC:25457. MTURN.
HPAHPA029507.
neXtProtNX_Q8N3F0.
PharmGKBPA147358571.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG39592.
HOGENOMHOG000069946.
HOVERGENHBG107664.
InParanoidQ8N3F0.
OMATDNFHVW.
OrthoDBEOG7M0NT8.
PhylomeDBQ8N3F0.
TreeFamTF332814.

Gene expression databases

ArrayExpressQ8N3F0.
BgeeQ8N3F0.
CleanExHS_C7orf41.
GenevestigatorQ8N3F0.

Family and domain databases

InterProIPR027892. DUF4581.
[Graphical view]
PANTHERPTHR32008. PTHR32008. 1 hit.
PfamPF15167. DUF4581. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

ChiTaRSC7orf41. human.
GenomeRNAi222166.
NextBio35481847.

Entry information

Entry nameMTURN_HUMAN
AccessionPrimary (citable) accession number: Q8N3F0
Secondary accession number(s): B8ZZW9 expand/collapse secondary AC list , Q8N791, Q8N8M4, Q8NEX2
Entry history
Integrated into UniProtKB/Swiss-Prot: July 10, 2007
Last sequence update: September 13, 2004
Last modified: July 9, 2014
This is version 73 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

Human chromosome 7

Human chromosome 7: entries, gene names and cross-references to MIM