Q8N3F0 (CG041_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
April 3, 2013.
Version 65.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: UPF0452 protein C7orf41 Alternative name(s): Protein Ells1 | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Reference proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 131 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Sequence similarities | Belongs to the UPF0452 family. |
Ontologies
| Keywords | |
|---|---|
| Coding sequence diversity | Alternative splicing |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| None. [Check GOA] | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q8N3F0-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q8N3F0-2) The sequence of this isoform differs from the canonical sequence as follows: 95-131: PLLGLPDADDDAFEEYSADVEEEEPEADHPQMGVSQQ → GLISAVHALPVETWLFFVLWQTGALEVVYV | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: Q8N3F0-3) The sequence of this isoform differs from the canonical sequence as follows: 1-54: MDFQQLADVAEKWCSNTPFELIATEETERRMDFYADPGVSFYVLCPDNGCGDNF → MATHCPLYCVGADLMMNRAGE | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 131 | 131 | UPF0452 protein C7orf41 | PRO_0000294233 | |||||
Regions | |||||||||
| Compositional bias | 115 – 120 | 6 | Poly-Glu | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 54 | 54 | MDFQQ…CGDNF → MATHCPLYCVGADLMMNRAG E in isoform 3. | VSP_026608 | |||||
| Alternative sequence | 95 – 131 | 37 | PLLGL…GVSQQ → GLISAVHALPVETWLFFVLW QTGALEVVYV in isoform 2. | VSP_026609 | |||||
Experimental info | |||||||||
| Sequence conflict | 82 | 1 | L → P in BAC04811. Ref.2 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AY054121 mRNA. Translation: AAL14866.1. AK096533 mRNA. Translation: BAC04811.1. AK098769 mRNA. Translation: BAC05408.1. AL834391 mRNA. Translation: CAD39053.2. |
| IPI | IPI00166546. IPI00168785. IPI00853183. |
| RefSeq | NP_690006.2. NM_152793.2. |
| UniGene | Hs.200100. |
3D structure databases | |
| ProteinModelPortal | Q8N3F0. |
| ModBase | Search... |
PTM databases | |
| PhosphoSite | Q8N3F0. |
Polymorphism databases | |
| DMDM | 74714835. |
Proteomic databases | |
| PaxDb | Q8N3F0. |
| PRIDE | Q8N3F0. |
Protocols and materials databases | |
| DNASU | 222166. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000324453; ENSP00000324204; ENSG00000180354. ENST00000324489; ENSP00000324755; ENSG00000180354. ENST00000415604; ENSP00000387585; ENSG00000180354. ENST00000455738; ENSP00000389035; ENSG00000180354. |
| GeneID | 222166. |
| KEGG | hsa:222166. |
| UCSC | uc003tar.1. human. |
Organism-specific databases | |
| CTD | 222166. |
| GeneCards | GC07P030141. |
| H-InvDB | HIX0006564. |
| HGNC | HGNC:25457. C7orf41. |
| HPA | HPA029507. |
| neXtProt | NX_Q8N3F0. |
| PharmGKB | PA147358571. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG39592. |
| HOGENOM | HOG000069946. |
| HOVERGEN | HBG107664. |
| InParanoid | Q8N3F0. |
| OMA | TDNFHVW. |
| OrthoDB | EOG47D9HH. |
Gene expression databases | |
| ArrayExpress | Q8N3F0. |
| Bgee | Q8N3F0. |
| CleanEx | HS_C7orf41. |
| Genevestigator | Q8N3F0. |
Family and domain databases | |
| ProtoNet | Search... |
Other | |
| ChiTaRS | C7orf41. human. |
| GenomeRNAi | 222166. |
| NextBio | 91556. |
Entry information
| Entry name | CG041_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q8N3F0 Secondary accession number(s): Q8N791, Q8N8M4, Q8NEX2 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Uncharacterized protein families (UPF) List of uncharacterized protein family (UPF) entries |
| Human chromosome 7 Human chromosome 7: entries, gene names and cross-references to MIM |
| SIMILARITY comments Index of protein domains and families |

Clusters with
