SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q8N3C0

- ASCC3_HUMAN

UniProt

Q8N3C0 - ASCC3_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Activating signal cointegrator 1 complex subunit 3

Gene
ASCC3, HELIC1
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

3'-5' DNA helicase involved in repair of alkylated DNA. Promotes DNA unwinding to generate single-stranded substrate needed for ALKHB3, enabling ALKHB3 to process alkylated N3-methylcytosine (3mC) within double-stranded regions. Enhances NF-kappa-B, SRF and AP1 transactivation.1 Publication

Catalytic activityi

ATP + H2O = ADP + phosphate.1 Publication

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Nucleotide bindingi499 – 5068ATP Reviewed prediction
Nucleotide bindingi1349 – 13568ATP Reviewed prediction

GO - Molecular functioni

  1. ATP binding Source: UniProtKB-KW
  2. ATP-dependent 3'-5' DNA helicase activity Source: UniProtKB
  3. poly(A) RNA binding Source: UniProtKB
  4. protein binding Source: UniProtKB

GO - Biological processi

  1. cell proliferation Source: UniProtKB
  2. DNA dealkylation involved in DNA repair Source: UniProtKB
  3. DNA duplex unwinding Source: UniProtKB
  4. regulation of transcription, DNA-templated Source: UniProtKB-KW
  5. transcription, DNA-templated Source: UniProtKB-KW
Complete GO annotation...

Keywords - Molecular functioni

Helicase, Hydrolase

Keywords - Biological processi

DNA damage, DNA repair, Transcription, Transcription regulation

Keywords - Ligandi

ATP-binding, Nucleotide-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Activating signal cointegrator 1 complex subunit 3 (EC:3.6.4.12)
Alternative name(s):
ASC-1 complex subunit p200
Short name:
ASC1p200
Helicase, ATP binding 1
Trip4 complex subunit p200
Gene namesi
Name:ASCC3
Synonyms:HELIC1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 6

Organism-specific databases

HGNCiHGNC:18697. ASCC3.

Subcellular locationi

GO - Cellular componenti

  1. cytoplasm Source: HPA
  2. Golgi apparatus Source: HPA
  3. intracellular Source: LIFEdb
  4. nucleus Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi1354 – 13541G → D: Abolishes 3'-5' DNA helicase activity and ability to promote DNA repair. 1 Publication

Organism-specific databases

PharmGKBiPA134890913.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 22022202Activating signal cointegrator 1 complex subunit 3PRO_0000102093Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei572 – 5721N6-acetyllysine1 Publication

Keywords - PTMi

Acetylation

Proteomic databases

MaxQBiQ8N3C0.
PaxDbiQ8N3C0.
PRIDEiQ8N3C0.

PTM databases

PhosphoSiteiQ8N3C0.

Expressioni

Tissue specificityi

Ubiquitous.

Gene expression databases

ArrayExpressiQ8N3C0.
BgeeiQ8N3C0.
CleanExiHS_ASCC3.
GenevestigatoriQ8N3C0.

Organism-specific databases

HPAiHPA031608.
HPA031609.
HPA031610.

Interactioni

Subunit structurei

Part of TRIP4 complex, that contains ASCC1, ASCC2 and ASCC3. The TRIP4 complex interacts with ALKBH3.2 Publications

Protein-protein interaction databases

BioGridi116170. 17 interactions.
IntActiQ8N3C0. 7 interactions.
MINTiMINT-1183138.
STRINGi9606.ENSP00000320252.

Structurei

3D structure databases

ProteinModelPortaliQ8N3C0.
SMRiQ8N3C0. Positions 472-925, 971-1280, 1327-2182.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini486 – 669184Helicase ATP-binding 1Add
BLAST
Domaini728 – 914187Helicase C-terminal 1Add
BLAST
Domaini978 – 1287310SEC63 1Add
BLAST
Domaini1336 – 1511176Helicase ATP-binding 2Add
BLAST
Domaini1544 – 1739196Helicase C-terminal 2Add
BLAST
Domaini1812 – 2176365SEC63 2Add
BLAST

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili18 – 7962 Reviewed predictionAdd
BLAST
Coiled coili328 – 35629 Reviewed predictionAdd
BLAST

Motif

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Motifi611 – 6144DEVH box
Motifi1453 – 14564DEIH box

Sequence similaritiesi

Belongs to the helicase family.
Contains 2 SEC63 domains.

Keywords - Domaini

Coiled coil, Repeat

Phylogenomic databases

eggNOGiCOG1204.
HOGENOMiHOG000152625.
HOVERGENiHBG051896.
InParanoidiQ8N3C0.
KOiK01529.
OMAiVHMLHDE.
OrthoDBiEOG7PGDPQ.
PhylomeDBiQ8N3C0.
TreeFamiTF105778.

Family and domain databases

Gene3Di2.60.40.150. 1 hit.
3.40.50.300. 4 hits.
InterProiIPR003593. AAA+_ATPase.
IPR000008. C2_dom.
IPR011545. DNA/RNA_helicase_DEAD/DEAH_N.
IPR014001. Helicase_ATP-bd.
IPR001650. Helicase_C.
IPR014756. Ig_E-set.
IPR027417. P-loop_NTPase.
IPR004179. Sec63-dom.
[Graphical view]
PfamiPF00270. DEAD. 2 hits.
PF00271. Helicase_C. 2 hits.
PF02889. Sec63. 2 hits.
[Graphical view]
SMARTiSM00382. AAA. 2 hits.
SM00487. DEXDc. 2 hits.
SM00490. HELICc. 2 hits.
SM00611. SEC63. 2 hits.
SM00973. Sec63. 2 hits.
[Graphical view]
SUPFAMiSSF52540. SSF52540. 4 hits.
SSF81296. SSF81296. 1 hit.
PROSITEiPS51192. HELICASE_ATP_BIND_1. 2 hits.
PS51194. HELICASE_CTER. 2 hits.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q8N3C0-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MALPRLTGAL RSFSNVTKQD NYNEEVADLK IKRSKLHEQV LDLGLTWKKI     50
IKFLNEKLEK SKMQSINEDL KDILHAAKQI VGTDNGREAI ESGAAFLFMT 100
FHLKDSVGHK ETKAIKQMFG PFPSSSATAA CNATNRIISH FSQDDLTALV 150
QMTEKEHGDR VFFGKNLAFS FDMHDLDHFD ELPINGETQK TISLDYKKFL 200
NEHLQEACTP ELKPVEKTNG SFLWCEVEKY LNSTLKEMTE VPRVEDLCCT 250
LYDMLASIKS GDELQDELFE LLGPEGLELI EKLLQNRITI VDRFLNSSND 300
HRFQALQDNC KKILGENAKP NYGCQVTIQS EQEKQLMKQY RREEKRIARR 350
EKKAGEDLEV SEGLMCFDPK ELRIQREQAL LNARSVPILS RQRDADVEKI 400
HYPHVYDSQA EAMKTSAFIA GAKMILPEGI QRENNKLYEE VRIPYSEPMP 450
LSFEEKPVYI QDLDEIGQLA FKGMKRLNRI QSIVFETAYN TNENMLICAP 500
TGAGKTNIAM LTVLHEIRQH FQQGVIKKNE FKIVYVAPMK ALAAEMTDYF 550
SRRLEPLGII VKELTGDMQL SKSEILRTQM LVTTPEKWDV VTRKSVGDVA 600
LSQIVRLLIL DEVHLLHEDR GPVLESIVAR TLRQVESTQS MIRILGLSAT 650
LPNYLDVATF LHVNPYIGLF FFDGRFRPVP LGQTFLGIKC ANKMQQLNNM 700
DEVCYENVLK QVKAGHQVMV FVHARNATVR TAMSLIERAK NCGHIPFFFP 750
TQGHDYVLAE KQVQRSRNKQ VRELFPDGFS IHHAGMLRQD RNLVENLFSN 800
GHIKVLVCTA TLAWGVNLPA HAVIIKGTQI YAAKRGSFVD LGILDVMQIF 850
GRAGRPQFDK FGEGIIITTH DKLSHYLTLL TQRNPIESQF LESLADNLNA 900
EIALGTVTNV EEAVKWISYT YLYVRMRANP LAYGISHKAY QIDPTLRKHR 950
EQLVIEVGRK LDKAQMIRFE ERTGYFSSTD LGRTASHYYI KYNTIETFNE 1000
LFDAHKTEGD IFAIVSKAEE FDQIKVREEE IEELDTLLSN FCELSTPGGV 1050
ENSYGKINIL LQTYISRGEM DSFSLISDSA YVAQNAARIV RALFEIALRK 1100
RWPTMTYRLL NLSKVIDKRL WGWASPLRQF SILPPHILTR LEEKKLTVDK 1150
LKDMRKDEIG HILHHVNIGL KVKQCVHQIP SVMMEASIQP ITRTVLRVTL 1200
SIYADFTWND QVHGTVGEPW WIWVEDPTND HIYHSEYFLA LKKQVISKEA 1250
QLLVFTIPIF EPLPSQYYIR AVSDRWLGAE AVCIINFQHL ILPERHPPHT 1300
ELLDLQPLPI TALGCKAYEA LYNFSHFNPV QTQIFHTLYH TDCNVLLGAP 1350
TGSGKTVAAE LAIFRVFNKY PTSKAVYIAP LKALVRERMD DWKVRIEEKL 1400
GKKVIELTGD VTPDMKSIAK ADLIVTTPEK WDGVSRSWQN RNYVQQVTIL 1450
IIDEIHLLGE ERGPVLEVIV SRTNFISSHT EKPVRIVGLS TALANARDLA 1500
DWLNIKQMGL FNFRPSVRPV PLEVHIQGFP GQHYCPRMAS MNKPAFQAIR 1550
SHSPAKPVLI FVSSRRQTRL TALELIAFLA TEEDPKQWLN MDEREMENII 1600
ATVRDSNLKL TLAFGIGMHH AGLHERDRKT VEELFVNCKV QVLIATSTLA 1650
WGVNFPAHLV IIKGTEYYDG KTRRYVDFPI TDVLQMMGRA GRPQFDDQGK 1700
AVILVHDIKK DFYKKFLYEP FPVESSLLGV LSDHLNAEIA GGTITSKQDA 1750
LDYITWTYFF RRLIMNPSYY NLGDVSHDSV NKFLSHLIEK SLIELELSYC 1800
IEIGEDNRSI EPLTYGRIAS YYYLKHQTVK MFKDRLKPEC STEELLSILS 1850
DAEEYTDLPV RHNEDHMNSE LAKCLPIESN PHSFDSPHTK AHLLLQAHLS 1900
RAMLPCPDYD TDTKTVLDQA LRVCQAMLDV AANQGWLVTV LNITNLIQMV 1950
IQGRWLKDSS LLTLPNIENH HLHLFKKWKP IMKGPHARGR TSIESLPELI 2000
HACGGKDHVF SSMVESELHA AKTKQAWNFL SHLPVINVGI SVKGSWDDLV 2050
EGHNELSVST LTADKRDDNK WIKLHADQEY VLQVSLQRVH FGFHKGKPES 2100
CAVTPRFPKS KDEGWFLILG EVDKRELIAL KRVGYIRNHH VASLSFYTPE 2150
IPGRYIYTLY FMSDCYLGLD QQYDIYLNVT QASLSAQVNT KVSDSLTDLA 2200
LK 2202
Length:2,202
Mass (Da):251,460
Last modified:September 11, 2007 - v3
Checksum:i9F074E6E5853399C
GO
Isoform 2 (identifier: Q8N3C0-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     81-111: VGTDNGREAIESGAAFLFMTFHLKDSVGHKE → EVNCPFQKRRLDGKEEDEKMSRASDRFRGLR
     112-2202: Missing.

Show »
Length:111
Mass (Da):13,014
Checksum:iF3D84693464682F3
GO
Isoform 3 (identifier: Q8N3C0-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     719-731: MVFVHARNATVRT → HLFYLLLHLFICF
     732-2202: Missing.

Show »
Length:731
Mass (Da):83,675
Checksum:iE82CDB32BEC21AF3
GO

Sequence cautioni

The sequence AAG45474.1 differs from that shown. Reason: Frameshift at position 2175.
The sequence CAA11679.1 differs from that shown. Reason: Frameshift at position 2175.
The sequence CAA11679.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti146 – 1461L → F.1 Publication
Corresponds to variant rs9390698 [ dbSNP | Ensembl ].
VAR_034859
Natural varianti344 – 3441E → K.
Corresponds to variant rs6918004 [ dbSNP | Ensembl ].
VAR_049339
Natural varianti478 – 4781N → S.
Corresponds to variant rs7750940 [ dbSNP | Ensembl ].
VAR_049340
Natural varianti1016 – 10161S → C.
Corresponds to variant rs57534235 [ dbSNP | Ensembl ].
VAR_061212
Natural varianti1050 – 10501V → I.
Corresponds to variant rs9497983 [ dbSNP | Ensembl ].
VAR_034860
Natural varianti1425 – 14251V → A.
Corresponds to variant rs17246013 [ dbSNP | Ensembl ].
VAR_049341
Natural varianti1497 – 14971R → T.
Corresponds to variant rs17305382 [ dbSNP | Ensembl ].
VAR_049342
Natural varianti1800 – 18001C → W.
Corresponds to variant rs35011147 [ dbSNP | Ensembl ].
VAR_034861
Natural varianti1930 – 19301V → M.
Corresponds to variant rs3213542 [ dbSNP | Ensembl ].
VAR_034862
Natural varianti1995 – 19951S → C.2 Publications
Corresponds to variant rs240780 [ dbSNP | Ensembl ].
VAR_034863
Natural varianti2176 – 21761Y → C.
Corresponds to variant rs240768 [ dbSNP | Ensembl ].
VAR_034864

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei81 – 11131VGTDN…VGHKE → EVNCPFQKRRLDGKEEDEKM SRASDRFRGLR in isoform 2. VSP_042955Add
BLAST
Alternative sequencei112 – 22022091Missing in isoform 2. VSP_042956Add
BLAST
Alternative sequencei719 – 73113MVFVH…ATVRT → HLFYLLLHLFICF in isoform 3. VSP_042957Add
BLAST
Alternative sequencei732 – 22021471Missing in isoform 3. VSP_042958Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti86 – 861G → E in AAH26066. 1 Publication
Sequence conflicti269 – 2779Missing in CAH73862. 1 Publication
Sequence conflicti269 – 2779Missing in CAI16190. 1 Publication
Sequence conflicti269 – 2779Missing in CAI19454. 1 Publication
Sequence conflicti269 – 2779Missing in CAI19627. 1 Publication
Sequence conflicti269 – 2779Missing in CAI21439. 1 Publication
Sequence conflicti444 – 4441P → S in CAD39122. 1 Publication
Sequence conflicti582 – 5821V → A in AAH26066. 1 Publication
Sequence conflicti750 – 7501P → S in CAD39122. 1 Publication
Sequence conflicti1187 – 11871S → F in CAA11679. 1 Publication
Sequence conflicti1343 – 13431C → S in CAA11679. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AL834463 mRNA. Translation: CAD39122.1.
AK315197 mRNA. Translation: BAG37637.1.
AL591585
, AL121965, AL133338, AL356122, Z86062 Genomic DNA. Translation: CAH73862.1.
AL356122
, AL121965, AL133338, AL591585, Z86062 Genomic DNA. Translation: CAI16190.1.
Z86062
, AL121965, AL133338, AL356122, AL591585 Genomic DNA. Translation: CAI19454.1.
AL121965
, AL133338, AL356122, AL591585, Z86062 Genomic DNA. Translation: CAI19627.1.
AL133338
, AL121965, AL356122, AL591585, Z86062 Genomic DNA. Translation: CAI21439.1.
AL133338 Genomic DNA. Translation: CAC07337.1.
CH471051 Genomic DNA. Translation: EAW48449.1.
BC050681 mRNA. Translation: AAH50681.1.
BC125211 mRNA. Translation: AAI25212.1.
BC125212 mRNA. Translation: AAI25213.1.
BC026066 mRNA. Translation: AAH26066.1.
AY013288 mRNA. Translation: AAG45474.1. Frameshift.
AJ223948 mRNA. Translation: CAA11679.1. Sequence problems.
CCDSiCCDS5046.1. [Q8N3C0-1]
CCDS5047.1. [Q8N3C0-3]
RefSeqiNP_001271200.1. NM_001284271.1. [Q8N3C0-4]
NP_006819.2. NM_006828.3. [Q8N3C0-1]
NP_071374.1. NM_022091.4. [Q8N3C0-3]
UniGeneiHs.486031.
Hs.733060.

Genome annotation databases

EnsembliENST00000369143; ENSP00000358139; ENSG00000112249. [Q8N3C0-3]
ENST00000369162; ENSP00000358159; ENSG00000112249. [Q8N3C0-1]
ENST00000522650; ENSP00000430769; ENSG00000112249. [Q8N3C0-4]
GeneIDi10973.
KEGGihsa:10973.
UCSCiuc003pqk.3. human. [Q8N3C0-1]
uc003pql.3. human. [Q8N3C0-4]
uc003pqm.3. human. [Q8N3C0-3]

Polymorphism databases

DMDMi158518649.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AL834463 mRNA. Translation: CAD39122.1 .
AK315197 mRNA. Translation: BAG37637.1 .
AL591585
, AL121965 , AL133338 , AL356122 , Z86062 Genomic DNA. Translation: CAH73862.1 .
AL356122
, AL121965 , AL133338 , AL591585 , Z86062 Genomic DNA. Translation: CAI16190.1 .
Z86062
, AL121965 , AL133338 , AL356122 , AL591585 Genomic DNA. Translation: CAI19454.1 .
AL121965
, AL133338 , AL356122 , AL591585 , Z86062 Genomic DNA. Translation: CAI19627.1 .
AL133338
, AL121965 , AL356122 , AL591585 , Z86062 Genomic DNA. Translation: CAI21439.1 .
AL133338 Genomic DNA. Translation: CAC07337.1 .
CH471051 Genomic DNA. Translation: EAW48449.1 .
BC050681 mRNA. Translation: AAH50681.1 .
BC125211 mRNA. Translation: AAI25212.1 .
BC125212 mRNA. Translation: AAI25213.1 .
BC026066 mRNA. Translation: AAH26066.1 .
AY013288 mRNA. Translation: AAG45474.1 . Frameshift.
AJ223948 mRNA. Translation: CAA11679.1 . Sequence problems.
CCDSi CCDS5046.1. [Q8N3C0-1 ]
CCDS5047.1. [Q8N3C0-3 ]
RefSeqi NP_001271200.1. NM_001284271.1. [Q8N3C0-4 ]
NP_006819.2. NM_006828.3. [Q8N3C0-1 ]
NP_071374.1. NM_022091.4. [Q8N3C0-3 ]
UniGenei Hs.486031.
Hs.733060.

3D structure databases

ProteinModelPortali Q8N3C0.
SMRi Q8N3C0. Positions 472-925, 971-1280, 1327-2182.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 116170. 17 interactions.
IntActi Q8N3C0. 7 interactions.
MINTi MINT-1183138.
STRINGi 9606.ENSP00000320252.

PTM databases

PhosphoSitei Q8N3C0.

Polymorphism databases

DMDMi 158518649.

Proteomic databases

MaxQBi Q8N3C0.
PaxDbi Q8N3C0.
PRIDEi Q8N3C0.

Protocols and materials databases

DNASUi 10973.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000369143 ; ENSP00000358139 ; ENSG00000112249 . [Q8N3C0-3 ]
ENST00000369162 ; ENSP00000358159 ; ENSG00000112249 . [Q8N3C0-1 ]
ENST00000522650 ; ENSP00000430769 ; ENSG00000112249 . [Q8N3C0-4 ]
GeneIDi 10973.
KEGGi hsa:10973.
UCSCi uc003pqk.3. human. [Q8N3C0-1 ]
uc003pql.3. human. [Q8N3C0-4 ]
uc003pqm.3. human. [Q8N3C0-3 ]

Organism-specific databases

CTDi 10973.
GeneCardsi GC06M100956.
H-InvDB HIX0021958.
HGNCi HGNC:18697. ASCC3.
HPAi HPA031608.
HPA031609.
HPA031610.
MIMi 614217. gene.
neXtProti NX_Q8N3C0.
PharmGKBi PA134890913.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG1204.
HOGENOMi HOG000152625.
HOVERGENi HBG051896.
InParanoidi Q8N3C0.
KOi K01529.
OMAi VHMLHDE.
OrthoDBi EOG7PGDPQ.
PhylomeDBi Q8N3C0.
TreeFami TF105778.

Miscellaneous databases

ChiTaRSi ASCC3. human.
GeneWikii ASCC3.
GenomeRNAii 10973.
NextBioi 41694.
PROi Q8N3C0.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q8N3C0.
Bgeei Q8N3C0.
CleanExi HS_ASCC3.
Genevestigatori Q8N3C0.

Family and domain databases

Gene3Di 2.60.40.150. 1 hit.
3.40.50.300. 4 hits.
InterProi IPR003593. AAA+_ATPase.
IPR000008. C2_dom.
IPR011545. DNA/RNA_helicase_DEAD/DEAH_N.
IPR014001. Helicase_ATP-bd.
IPR001650. Helicase_C.
IPR014756. Ig_E-set.
IPR027417. P-loop_NTPase.
IPR004179. Sec63-dom.
[Graphical view ]
Pfami PF00270. DEAD. 2 hits.
PF00271. Helicase_C. 2 hits.
PF02889. Sec63. 2 hits.
[Graphical view ]
SMARTi SM00382. AAA. 2 hits.
SM00487. DEXDc. 2 hits.
SM00490. HELICc. 2 hits.
SM00611. SEC63. 2 hits.
SM00973. Sec63. 2 hits.
[Graphical view ]
SUPFAMi SSF52540. SSF52540. 4 hits.
SSF81296. SSF81296. 1 hit.
PROSITEi PS51192. HELICASE_ATP_BIND_1. 2 hits.
PS51194. HELICASE_CTER. 2 hits.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT PHE-146.
    Tissue: Melanoma.
  2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Thymus.
  3. "The DNA sequence and analysis of human chromosome 6."
    Mungall A.J., Palmer S.A., Sims S.K., Edwards C.A., Ashurst J.L., Wilming L., Jones M.C., Horton R., Hunt S.E., Scott C.E., Gilbert J.G.R., Clamp M.E., Bethel G., Milne S., Ainscough R., Almeida J.P., Ambrose K.D., Andrews T.D.
    , Ashwell R.I.S., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beare D.M., Beasley H., Beasley O., Bird C.P., Blakey S.E., Bray-Allen S., Brook J., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Clark S.Y., Clark G., Clee C.M., Clegg S., Cobley V., Collier R.E., Collins J.E., Colman L.K., Corby N.R., Coville G.J., Culley K.M., Dhami P., Davies J., Dunn M., Earthrowl M.E., Ellington A.E., Evans K.A., Faulkner L., Francis M.D., Frankish A., Frankland J., French L., Garner P., Garnett J., Ghori M.J., Gilby L.M., Gillson C.J., Glithero R.J., Grafham D.V., Grant M., Gribble S., Griffiths C., Griffiths M.N.D., Hall R., Halls K.S., Hammond S., Harley J.L., Hart E.A., Heath P.D., Heathcott R., Holmes S.J., Howden P.J., Howe K.L., Howell G.R., Huckle E., Humphray S.J., Humphries M.D., Hunt A.R., Johnson C.M., Joy A.A., Kay M., Keenan S.J., Kimberley A.M., King A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C.R., Lloyd D.M., Loveland J.E., Lovell J., Martin S., Mashreghi-Mohammadi M., Maslen G.L., Matthews L., McCann O.T., McLaren S.J., McLay K., McMurray A., Moore M.J.F., Mullikin J.C., Niblett D., Nickerson T., Novik K.L., Oliver K., Overton-Larty E.K., Parker A., Patel R., Pearce A.V., Peck A.I., Phillimore B.J.C.T., Phillips S., Plumb R.W., Porter K.M., Ramsey Y., Ranby S.A., Rice C.M., Ross M.T., Searle S.M., Sehra H.K., Sheridan E., Skuce C.D., Smith S., Smith M., Spraggon L., Squares S.L., Steward C.A., Sycamore N., Tamlyn-Hall G., Tester J., Theaker A.J., Thomas D.W., Thorpe A., Tracey A., Tromans A., Tubby B., Wall M., Wallis J.M., West A.P., White S.S., Whitehead S.L., Whittaker H., Wild A., Willey D.J., Wilmer T.E., Wood J.M., Wray P.W., Wyatt J.C., Young L., Younger R.M., Bentley D.R., Coulson A., Durbin R.M., Hubbard T., Sulston J.E., Dunham I., Rogers J., Beck S.
    Nature 425:805-811(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3).
    Tissue: Skin and Testis.
  6. "Novel transcription coactivator complex containing activating signal cointegrator 1."
    Jung D.-J., Sung H.-S., Goo Y.-W., Lee H.M., Park O.K., Jung S.-Y., Lim J., Kim H.-J., Lee S.-K., Kim T.S., Lee J.W., Lee Y.C.
    Mol. Cell. Biol. 22:5203-5211(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 277-2202, PARTIAL PROTEIN SEQUENCE, VARIANT CYS-1995, INTERACTION WITH ASCC1 AND ASCC2.
    Tissue: Cervix carcinoma.
  7. "The immunodominant antigen recognized by autologous CTL on a human melanoma is generated by a point mutation in a new member of the RNA helicase gene family."
    Baurain J.-F.
    Submitted (FEB-1998) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1012-2202, VARIANT CYS-1995.
    Tissue: Melanoma.
  8. "Lysine acetylation targets protein complexes and co-regulates major cellular functions."
    Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.C., Olsen J.V., Mann M.
    Science 325:834-840(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-572, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  9. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  10. "DNA unwinding by ASCC3 helicase is coupled to ALKBH3-dependent DNA alkylation repair and cancer cell proliferation."
    Dango S., Mosammaparast N., Sowa M.E., Xiong L.J., Wu F., Park K., Rubin M., Gygi S., Harper J.W., Shi Y.
    Mol. Cell 44:373-384(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, CATALYTIC ACTIVITY, INTERACTION WITH ALKBH3, MUTAGENESIS OF GLY-1354.

Entry informationi

Entry nameiASCC3_HUMAN
AccessioniPrimary (citable) accession number: Q8N3C0
Secondary accession number(s): E7EW23
, O43738, Q4G1A0, Q5VTN2, Q9H1I9, Q9H5A2, Q9NTR0
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 19, 2004
Last sequence update: September 11, 2007
Last modified: September 3, 2014
This is version 124 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 6
    Human chromosome 6: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi