Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q8N3C0

- ASCC3_HUMAN

UniProt

Q8N3C0 - ASCC3_HUMAN

Protein

Activating signal cointegrator 1 complex subunit 3

Gene

ASCC3

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 125 (01 Oct 2014)
      Sequence version 3 (11 Sep 2007)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    3'-5' DNA helicase involved in repair of alkylated DNA. Promotes DNA unwinding to generate single-stranded substrate needed for ALKHB3, enabling ALKHB3 to process alkylated N3-methylcytosine (3mC) within double-stranded regions. Enhances NF-kappa-B, SRF and AP1 transactivation.1 Publication

    Catalytic activityi

    ATP + H2O = ADP + phosphate.1 Publication

    Regions

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Nucleotide bindingi499 – 5068ATPPROSITE-ProRule annotation
    Nucleotide bindingi1349 – 13568ATPPROSITE-ProRule annotation

    GO - Molecular functioni

    1. ATP binding Source: UniProtKB-KW
    2. ATP-dependent 3'-5' DNA helicase activity Source: UniProtKB
    3. poly(A) RNA binding Source: UniProtKB
    4. protein binding Source: UniProtKB

    GO - Biological processi

    1. cell proliferation Source: UniProtKB
    2. DNA dealkylation involved in DNA repair Source: UniProtKB
    3. DNA duplex unwinding Source: UniProtKB
    4. regulation of transcription, DNA-templated Source: UniProtKB-KW
    5. transcription, DNA-templated Source: UniProtKB-KW

    Keywords - Molecular functioni

    Helicase, Hydrolase

    Keywords - Biological processi

    DNA damage, DNA repair, Transcription, Transcription regulation

    Keywords - Ligandi

    ATP-binding, Nucleotide-binding

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Activating signal cointegrator 1 complex subunit 3 (EC:3.6.4.12)
    Alternative name(s):
    ASC-1 complex subunit p200
    Short name:
    ASC1p200
    Helicase, ATP binding 1
    Trip4 complex subunit p200
    Gene namesi
    Name:ASCC3
    Synonyms:HELIC1
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 6

    Organism-specific databases

    HGNCiHGNC:18697. ASCC3.

    Subcellular locationi

    GO - Cellular componenti

    1. cytoplasm Source: HPA
    2. Golgi apparatus Source: HPA
    3. intracellular Source: LIFEdb
    4. membrane Source: UniProtKB
    5. nucleus Source: UniProtKB

    Keywords - Cellular componenti

    Cytoplasm, Nucleus

    Pathology & Biotechi

    Mutagenesis

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Mutagenesisi1354 – 13541G → D: Abolishes 3'-5' DNA helicase activity and ability to promote DNA repair. 1 Publication

    Organism-specific databases

    PharmGKBiPA134890913.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 22022202Activating signal cointegrator 1 complex subunit 3PRO_0000102093Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei572 – 5721N6-acetyllysine1 Publication

    Keywords - PTMi

    Acetylation

    Proteomic databases

    MaxQBiQ8N3C0.
    PaxDbiQ8N3C0.
    PRIDEiQ8N3C0.

    PTM databases

    PhosphoSiteiQ8N3C0.

    Expressioni

    Tissue specificityi

    Ubiquitous.

    Gene expression databases

    ArrayExpressiQ8N3C0.
    BgeeiQ8N3C0.
    CleanExiHS_ASCC3.
    GenevestigatoriQ8N3C0.

    Organism-specific databases

    HPAiHPA031608.
    HPA031609.
    HPA031610.

    Interactioni

    Subunit structurei

    Part of TRIP4 complex, that contains ASCC1, ASCC2 and ASCC3. The TRIP4 complex interacts with ALKBH3.2 Publications

    Protein-protein interaction databases

    BioGridi116170. 17 interactions.
    IntActiQ8N3C0. 7 interactions.
    MINTiMINT-1183138.
    STRINGi9606.ENSP00000320252.

    Structurei

    3D structure databases

    ProteinModelPortaliQ8N3C0.
    SMRiQ8N3C0. Positions 472-925, 971-1280, 1327-2182.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini486 – 669184Helicase ATP-binding 1PROSITE-ProRule annotationAdd
    BLAST
    Domaini728 – 914187Helicase C-terminal 1PROSITE-ProRule annotationAdd
    BLAST
    Domaini978 – 1287310SEC63 1Add
    BLAST
    Domaini1336 – 1511176Helicase ATP-binding 2PROSITE-ProRule annotationAdd
    BLAST
    Domaini1544 – 1739196Helicase C-terminal 2PROSITE-ProRule annotationAdd
    BLAST
    Domaini1812 – 2176365SEC63 2Add
    BLAST

    Coiled coil

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Coiled coili18 – 7962Sequence AnalysisAdd
    BLAST
    Coiled coili328 – 35629Sequence AnalysisAdd
    BLAST

    Motif

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Motifi611 – 6144DEVH box
    Motifi1453 – 14564DEIH box

    Sequence similaritiesi

    Belongs to the helicase family.Curated
    Contains 2 helicase ATP-binding domains.PROSITE-ProRule annotation
    Contains 2 helicase C-terminal domains.PROSITE-ProRule annotation
    Contains 2 SEC63 domains.Curated

    Keywords - Domaini

    Coiled coil, Repeat

    Phylogenomic databases

    eggNOGiCOG1204.
    HOGENOMiHOG000152625.
    HOVERGENiHBG051896.
    InParanoidiQ8N3C0.
    KOiK01529.
    OMAiVHMLHDE.
    OrthoDBiEOG7PGDPQ.
    PhylomeDBiQ8N3C0.
    TreeFamiTF105778.

    Family and domain databases

    Gene3Di2.60.40.150. 1 hit.
    3.40.50.300. 4 hits.
    InterProiIPR003593. AAA+_ATPase.
    IPR000008. C2_dom.
    IPR011545. DNA/RNA_helicase_DEAD/DEAH_N.
    IPR014001. Helicase_ATP-bd.
    IPR001650. Helicase_C.
    IPR014756. Ig_E-set.
    IPR027417. P-loop_NTPase.
    IPR004179. Sec63-dom.
    [Graphical view]
    PfamiPF00270. DEAD. 2 hits.
    PF00271. Helicase_C. 2 hits.
    PF02889. Sec63. 2 hits.
    [Graphical view]
    SMARTiSM00382. AAA. 2 hits.
    SM00487. DEXDc. 2 hits.
    SM00490. HELICc. 2 hits.
    SM00611. SEC63. 2 hits.
    SM00973. Sec63. 2 hits.
    [Graphical view]
    SUPFAMiSSF52540. SSF52540. 4 hits.
    SSF81296. SSF81296. 1 hit.
    PROSITEiPS51192. HELICASE_ATP_BIND_1. 2 hits.
    PS51194. HELICASE_CTER. 2 hits.
    [Graphical view]

    Sequences (3)i

    Sequence statusi: Complete.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q8N3C0-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MALPRLTGAL RSFSNVTKQD NYNEEVADLK IKRSKLHEQV LDLGLTWKKI     50
    IKFLNEKLEK SKMQSINEDL KDILHAAKQI VGTDNGREAI ESGAAFLFMT 100
    FHLKDSVGHK ETKAIKQMFG PFPSSSATAA CNATNRIISH FSQDDLTALV 150
    QMTEKEHGDR VFFGKNLAFS FDMHDLDHFD ELPINGETQK TISLDYKKFL 200
    NEHLQEACTP ELKPVEKTNG SFLWCEVEKY LNSTLKEMTE VPRVEDLCCT 250
    LYDMLASIKS GDELQDELFE LLGPEGLELI EKLLQNRITI VDRFLNSSND 300
    HRFQALQDNC KKILGENAKP NYGCQVTIQS EQEKQLMKQY RREEKRIARR 350
    EKKAGEDLEV SEGLMCFDPK ELRIQREQAL LNARSVPILS RQRDADVEKI 400
    HYPHVYDSQA EAMKTSAFIA GAKMILPEGI QRENNKLYEE VRIPYSEPMP 450
    LSFEEKPVYI QDLDEIGQLA FKGMKRLNRI QSIVFETAYN TNENMLICAP 500
    TGAGKTNIAM LTVLHEIRQH FQQGVIKKNE FKIVYVAPMK ALAAEMTDYF 550
    SRRLEPLGII VKELTGDMQL SKSEILRTQM LVTTPEKWDV VTRKSVGDVA 600
    LSQIVRLLIL DEVHLLHEDR GPVLESIVAR TLRQVESTQS MIRILGLSAT 650
    LPNYLDVATF LHVNPYIGLF FFDGRFRPVP LGQTFLGIKC ANKMQQLNNM 700
    DEVCYENVLK QVKAGHQVMV FVHARNATVR TAMSLIERAK NCGHIPFFFP 750
    TQGHDYVLAE KQVQRSRNKQ VRELFPDGFS IHHAGMLRQD RNLVENLFSN 800
    GHIKVLVCTA TLAWGVNLPA HAVIIKGTQI YAAKRGSFVD LGILDVMQIF 850
    GRAGRPQFDK FGEGIIITTH DKLSHYLTLL TQRNPIESQF LESLADNLNA 900
    EIALGTVTNV EEAVKWISYT YLYVRMRANP LAYGISHKAY QIDPTLRKHR 950
    EQLVIEVGRK LDKAQMIRFE ERTGYFSSTD LGRTASHYYI KYNTIETFNE 1000
    LFDAHKTEGD IFAIVSKAEE FDQIKVREEE IEELDTLLSN FCELSTPGGV 1050
    ENSYGKINIL LQTYISRGEM DSFSLISDSA YVAQNAARIV RALFEIALRK 1100
    RWPTMTYRLL NLSKVIDKRL WGWASPLRQF SILPPHILTR LEEKKLTVDK 1150
    LKDMRKDEIG HILHHVNIGL KVKQCVHQIP SVMMEASIQP ITRTVLRVTL 1200
    SIYADFTWND QVHGTVGEPW WIWVEDPTND HIYHSEYFLA LKKQVISKEA 1250
    QLLVFTIPIF EPLPSQYYIR AVSDRWLGAE AVCIINFQHL ILPERHPPHT 1300
    ELLDLQPLPI TALGCKAYEA LYNFSHFNPV QTQIFHTLYH TDCNVLLGAP 1350
    TGSGKTVAAE LAIFRVFNKY PTSKAVYIAP LKALVRERMD DWKVRIEEKL 1400
    GKKVIELTGD VTPDMKSIAK ADLIVTTPEK WDGVSRSWQN RNYVQQVTIL 1450
    IIDEIHLLGE ERGPVLEVIV SRTNFISSHT EKPVRIVGLS TALANARDLA 1500
    DWLNIKQMGL FNFRPSVRPV PLEVHIQGFP GQHYCPRMAS MNKPAFQAIR 1550
    SHSPAKPVLI FVSSRRQTRL TALELIAFLA TEEDPKQWLN MDEREMENII 1600
    ATVRDSNLKL TLAFGIGMHH AGLHERDRKT VEELFVNCKV QVLIATSTLA 1650
    WGVNFPAHLV IIKGTEYYDG KTRRYVDFPI TDVLQMMGRA GRPQFDDQGK 1700
    AVILVHDIKK DFYKKFLYEP FPVESSLLGV LSDHLNAEIA GGTITSKQDA 1750
    LDYITWTYFF RRLIMNPSYY NLGDVSHDSV NKFLSHLIEK SLIELELSYC 1800
    IEIGEDNRSI EPLTYGRIAS YYYLKHQTVK MFKDRLKPEC STEELLSILS 1850
    DAEEYTDLPV RHNEDHMNSE LAKCLPIESN PHSFDSPHTK AHLLLQAHLS 1900
    RAMLPCPDYD TDTKTVLDQA LRVCQAMLDV AANQGWLVTV LNITNLIQMV 1950
    IQGRWLKDSS LLTLPNIENH HLHLFKKWKP IMKGPHARGR TSIESLPELI 2000
    HACGGKDHVF SSMVESELHA AKTKQAWNFL SHLPVINVGI SVKGSWDDLV 2050
    EGHNELSVST LTADKRDDNK WIKLHADQEY VLQVSLQRVH FGFHKGKPES 2100
    CAVTPRFPKS KDEGWFLILG EVDKRELIAL KRVGYIRNHH VASLSFYTPE 2150
    IPGRYIYTLY FMSDCYLGLD QQYDIYLNVT QASLSAQVNT KVSDSLTDLA 2200
    LK 2202
    Length:2,202
    Mass (Da):251,460
    Last modified:September 11, 2007 - v3
    Checksum:i9F074E6E5853399C
    GO
    Isoform 2 (identifier: Q8N3C0-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         81-111: VGTDNGREAIESGAAFLFMTFHLKDSVGHKE → EVNCPFQKRRLDGKEEDEKMSRASDRFRGLR
         112-2202: Missing.

    Show »
    Length:111
    Mass (Da):13,014
    Checksum:iF3D84693464682F3
    GO
    Isoform 3 (identifier: Q8N3C0-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         719-731: MVFVHARNATVRT → HLFYLLLHLFICF
         732-2202: Missing.

    Show »
    Length:731
    Mass (Da):83,675
    Checksum:iE82CDB32BEC21AF3
    GO

    Sequence cautioni

    The sequence AAG45474.1 differs from that shown. Reason: Frameshift at position 2175.
    The sequence CAA11679.1 differs from that shown. Reason: Frameshift at position 2175.
    The sequence CAA11679.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti86 – 861G → E in AAH26066. (PubMed:15489334)Curated
    Sequence conflicti269 – 2779Missing in CAH73862. (PubMed:14702039)Curated
    Sequence conflicti269 – 2779Missing in CAI16190. (PubMed:14702039)Curated
    Sequence conflicti269 – 2779Missing in CAI19454. (PubMed:14702039)Curated
    Sequence conflicti269 – 2779Missing in CAI19627. (PubMed:14702039)Curated
    Sequence conflicti269 – 2779Missing in CAI21439. (PubMed:14702039)Curated
    Sequence conflicti444 – 4441P → S in CAD39122. (PubMed:17974005)Curated
    Sequence conflicti582 – 5821V → A in AAH26066. (PubMed:15489334)Curated
    Sequence conflicti750 – 7501P → S in CAD39122. (PubMed:17974005)Curated
    Sequence conflicti1187 – 11871S → F in CAA11679. 1 PublicationCurated
    Sequence conflicti1343 – 13431C → S in CAA11679. 1 PublicationCurated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti146 – 1461L → F.1 Publication
    Corresponds to variant rs9390698 [ dbSNP | Ensembl ].
    VAR_034859
    Natural varianti344 – 3441E → K.
    Corresponds to variant rs6918004 [ dbSNP | Ensembl ].
    VAR_049339
    Natural varianti478 – 4781N → S.
    Corresponds to variant rs7750940 [ dbSNP | Ensembl ].
    VAR_049340
    Natural varianti1016 – 10161S → C.
    Corresponds to variant rs57534235 [ dbSNP | Ensembl ].
    VAR_061212
    Natural varianti1050 – 10501V → I.
    Corresponds to variant rs9497983 [ dbSNP | Ensembl ].
    VAR_034860
    Natural varianti1425 – 14251V → A.
    Corresponds to variant rs17246013 [ dbSNP | Ensembl ].
    VAR_049341
    Natural varianti1497 – 14971R → T.
    Corresponds to variant rs17305382 [ dbSNP | Ensembl ].
    VAR_049342
    Natural varianti1800 – 18001C → W.
    Corresponds to variant rs35011147 [ dbSNP | Ensembl ].
    VAR_034861
    Natural varianti1930 – 19301V → M.
    Corresponds to variant rs3213542 [ dbSNP | Ensembl ].
    VAR_034862
    Natural varianti1995 – 19951S → C.2 Publications
    Corresponds to variant rs240780 [ dbSNP | Ensembl ].
    VAR_034863
    Natural varianti2176 – 21761Y → C.
    Corresponds to variant rs240768 [ dbSNP | Ensembl ].
    VAR_034864

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei81 – 11131VGTDN…VGHKE → EVNCPFQKRRLDGKEEDEKM SRASDRFRGLR in isoform 2. 2 PublicationsVSP_042955Add
    BLAST
    Alternative sequencei112 – 22022091Missing in isoform 2. 2 PublicationsVSP_042956Add
    BLAST
    Alternative sequencei719 – 73113MVFVH…ATVRT → HLFYLLLHLFICF in isoform 3. 1 PublicationVSP_042957Add
    BLAST
    Alternative sequencei732 – 22021471Missing in isoform 3. 1 PublicationVSP_042958Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AL834463 mRNA. Translation: CAD39122.1.
    AK315197 mRNA. Translation: BAG37637.1.
    AL591585
    , AL121965, AL133338, AL356122, Z86062 Genomic DNA. Translation: CAH73862.1.
    AL356122
    , AL121965, AL133338, AL591585, Z86062 Genomic DNA. Translation: CAI16190.1.
    Z86062
    , AL121965, AL133338, AL356122, AL591585 Genomic DNA. Translation: CAI19454.1.
    AL121965
    , AL133338, AL356122, AL591585, Z86062 Genomic DNA. Translation: CAI19627.1.
    AL133338
    , AL121965, AL356122, AL591585, Z86062 Genomic DNA. Translation: CAI21439.1.
    AL133338 Genomic DNA. Translation: CAC07337.1.
    CH471051 Genomic DNA. Translation: EAW48449.1.
    BC050681 mRNA. Translation: AAH50681.1.
    BC125211 mRNA. Translation: AAI25212.1.
    BC125212 mRNA. Translation: AAI25213.1.
    BC026066 mRNA. Translation: AAH26066.1.
    AY013288 mRNA. Translation: AAG45474.1. Frameshift.
    AJ223948 mRNA. Translation: CAA11679.1. Sequence problems.
    CCDSiCCDS5046.1. [Q8N3C0-1]
    CCDS5047.1. [Q8N3C0-3]
    RefSeqiNP_001271200.1. NM_001284271.1. [Q8N3C0-4]
    NP_006819.2. NM_006828.3. [Q8N3C0-1]
    NP_071374.1. NM_022091.4. [Q8N3C0-3]
    UniGeneiHs.486031.
    Hs.733060.

    Genome annotation databases

    EnsembliENST00000369143; ENSP00000358139; ENSG00000112249. [Q8N3C0-3]
    ENST00000369162; ENSP00000358159; ENSG00000112249. [Q8N3C0-1]
    ENST00000522650; ENSP00000430769; ENSG00000112249. [Q8N3C0-4]
    GeneIDi10973.
    KEGGihsa:10973.
    UCSCiuc003pqk.3. human. [Q8N3C0-1]
    uc003pql.3. human. [Q8N3C0-4]
    uc003pqm.3. human. [Q8N3C0-3]

    Polymorphism databases

    DMDMi158518649.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AL834463 mRNA. Translation: CAD39122.1 .
    AK315197 mRNA. Translation: BAG37637.1 .
    AL591585
    , AL121965 , AL133338 , AL356122 , Z86062 Genomic DNA. Translation: CAH73862.1 .
    AL356122
    , AL121965 , AL133338 , AL591585 , Z86062 Genomic DNA. Translation: CAI16190.1 .
    Z86062
    , AL121965 , AL133338 , AL356122 , AL591585 Genomic DNA. Translation: CAI19454.1 .
    AL121965
    , AL133338 , AL356122 , AL591585 , Z86062 Genomic DNA. Translation: CAI19627.1 .
    AL133338
    , AL121965 , AL356122 , AL591585 , Z86062 Genomic DNA. Translation: CAI21439.1 .
    AL133338 Genomic DNA. Translation: CAC07337.1 .
    CH471051 Genomic DNA. Translation: EAW48449.1 .
    BC050681 mRNA. Translation: AAH50681.1 .
    BC125211 mRNA. Translation: AAI25212.1 .
    BC125212 mRNA. Translation: AAI25213.1 .
    BC026066 mRNA. Translation: AAH26066.1 .
    AY013288 mRNA. Translation: AAG45474.1 . Frameshift.
    AJ223948 mRNA. Translation: CAA11679.1 . Sequence problems.
    CCDSi CCDS5046.1. [Q8N3C0-1 ]
    CCDS5047.1. [Q8N3C0-3 ]
    RefSeqi NP_001271200.1. NM_001284271.1. [Q8N3C0-4 ]
    NP_006819.2. NM_006828.3. [Q8N3C0-1 ]
    NP_071374.1. NM_022091.4. [Q8N3C0-3 ]
    UniGenei Hs.486031.
    Hs.733060.

    3D structure databases

    ProteinModelPortali Q8N3C0.
    SMRi Q8N3C0. Positions 472-925, 971-1280, 1327-2182.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 116170. 17 interactions.
    IntActi Q8N3C0. 7 interactions.
    MINTi MINT-1183138.
    STRINGi 9606.ENSP00000320252.

    PTM databases

    PhosphoSitei Q8N3C0.

    Polymorphism databases

    DMDMi 158518649.

    Proteomic databases

    MaxQBi Q8N3C0.
    PaxDbi Q8N3C0.
    PRIDEi Q8N3C0.

    Protocols and materials databases

    DNASUi 10973.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000369143 ; ENSP00000358139 ; ENSG00000112249 . [Q8N3C0-3 ]
    ENST00000369162 ; ENSP00000358159 ; ENSG00000112249 . [Q8N3C0-1 ]
    ENST00000522650 ; ENSP00000430769 ; ENSG00000112249 . [Q8N3C0-4 ]
    GeneIDi 10973.
    KEGGi hsa:10973.
    UCSCi uc003pqk.3. human. [Q8N3C0-1 ]
    uc003pql.3. human. [Q8N3C0-4 ]
    uc003pqm.3. human. [Q8N3C0-3 ]

    Organism-specific databases

    CTDi 10973.
    GeneCardsi GC06M100956.
    H-InvDB HIX0021958.
    HGNCi HGNC:18697. ASCC3.
    HPAi HPA031608.
    HPA031609.
    HPA031610.
    MIMi 614217. gene.
    neXtProti NX_Q8N3C0.
    PharmGKBi PA134890913.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG1204.
    HOGENOMi HOG000152625.
    HOVERGENi HBG051896.
    InParanoidi Q8N3C0.
    KOi K01529.
    OMAi VHMLHDE.
    OrthoDBi EOG7PGDPQ.
    PhylomeDBi Q8N3C0.
    TreeFami TF105778.

    Miscellaneous databases

    ChiTaRSi ASCC3. human.
    GeneWikii ASCC3.
    GenomeRNAii 10973.
    NextBioi 41694.
    PROi Q8N3C0.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q8N3C0.
    Bgeei Q8N3C0.
    CleanExi HS_ASCC3.
    Genevestigatori Q8N3C0.

    Family and domain databases

    Gene3Di 2.60.40.150. 1 hit.
    3.40.50.300. 4 hits.
    InterProi IPR003593. AAA+_ATPase.
    IPR000008. C2_dom.
    IPR011545. DNA/RNA_helicase_DEAD/DEAH_N.
    IPR014001. Helicase_ATP-bd.
    IPR001650. Helicase_C.
    IPR014756. Ig_E-set.
    IPR027417. P-loop_NTPase.
    IPR004179. Sec63-dom.
    [Graphical view ]
    Pfami PF00270. DEAD. 2 hits.
    PF00271. Helicase_C. 2 hits.
    PF02889. Sec63. 2 hits.
    [Graphical view ]
    SMARTi SM00382. AAA. 2 hits.
    SM00487. DEXDc. 2 hits.
    SM00490. HELICc. 2 hits.
    SM00611. SEC63. 2 hits.
    SM00973. Sec63. 2 hits.
    [Graphical view ]
    SUPFAMi SSF52540. SSF52540. 4 hits.
    SSF81296. SSF81296. 1 hit.
    PROSITEi PS51192. HELICASE_ATP_BIND_1. 2 hits.
    PS51194. HELICASE_CTER. 2 hits.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT PHE-146.
      Tissue: Melanoma.
    2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
      Tissue: Thymus.
    3. "The DNA sequence and analysis of human chromosome 6."
      Mungall A.J., Palmer S.A., Sims S.K., Edwards C.A., Ashurst J.L., Wilming L., Jones M.C., Horton R., Hunt S.E., Scott C.E., Gilbert J.G.R., Clamp M.E., Bethel G., Milne S., Ainscough R., Almeida J.P., Ambrose K.D., Andrews T.D.
      , Ashwell R.I.S., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beare D.M., Beasley H., Beasley O., Bird C.P., Blakey S.E., Bray-Allen S., Brook J., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Clark S.Y., Clark G., Clee C.M., Clegg S., Cobley V., Collier R.E., Collins J.E., Colman L.K., Corby N.R., Coville G.J., Culley K.M., Dhami P., Davies J., Dunn M., Earthrowl M.E., Ellington A.E., Evans K.A., Faulkner L., Francis M.D., Frankish A., Frankland J., French L., Garner P., Garnett J., Ghori M.J., Gilby L.M., Gillson C.J., Glithero R.J., Grafham D.V., Grant M., Gribble S., Griffiths C., Griffiths M.N.D., Hall R., Halls K.S., Hammond S., Harley J.L., Hart E.A., Heath P.D., Heathcott R., Holmes S.J., Howden P.J., Howe K.L., Howell G.R., Huckle E., Humphray S.J., Humphries M.D., Hunt A.R., Johnson C.M., Joy A.A., Kay M., Keenan S.J., Kimberley A.M., King A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C.R., Lloyd D.M., Loveland J.E., Lovell J., Martin S., Mashreghi-Mohammadi M., Maslen G.L., Matthews L., McCann O.T., McLaren S.J., McLay K., McMurray A., Moore M.J.F., Mullikin J.C., Niblett D., Nickerson T., Novik K.L., Oliver K., Overton-Larty E.K., Parker A., Patel R., Pearce A.V., Peck A.I., Phillimore B.J.C.T., Phillips S., Plumb R.W., Porter K.M., Ramsey Y., Ranby S.A., Rice C.M., Ross M.T., Searle S.M., Sehra H.K., Sheridan E., Skuce C.D., Smith S., Smith M., Spraggon L., Squares S.L., Steward C.A., Sycamore N., Tamlyn-Hall G., Tester J., Theaker A.J., Thomas D.W., Thorpe A., Tracey A., Tromans A., Tubby B., Wall M., Wallis J.M., West A.P., White S.S., Whitehead S.L., Whittaker H., Wild A., Willey D.J., Wilmer T.E., Wood J.M., Wray P.W., Wyatt J.C., Young L., Younger R.M., Bentley D.R., Coulson A., Durbin R.M., Hubbard T., Sulston J.E., Dunham I., Rogers J., Beck S.
      Nature 425:805-811(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3).
      Tissue: Skin and Testis.
    6. "Novel transcription coactivator complex containing activating signal cointegrator 1."
      Jung D.-J., Sung H.-S., Goo Y.-W., Lee H.M., Park O.K., Jung S.-Y., Lim J., Kim H.-J., Lee S.-K., Kim T.S., Lee J.W., Lee Y.C.
      Mol. Cell. Biol. 22:5203-5211(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 277-2202, PARTIAL PROTEIN SEQUENCE, VARIANT CYS-1995, INTERACTION WITH ASCC1 AND ASCC2.
      Tissue: Cervix carcinoma.
    7. "The immunodominant antigen recognized by autologous CTL on a human melanoma is generated by a point mutation in a new member of the RNA helicase gene family."
      Baurain J.-F.
      Submitted (FEB-1998) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1012-2202, VARIANT CYS-1995.
      Tissue: Melanoma.
    8. "Lysine acetylation targets protein complexes and co-regulates major cellular functions."
      Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.C., Olsen J.V., Mann M.
      Science 325:834-840(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-572, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    9. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    10. "DNA unwinding by ASCC3 helicase is coupled to ALKBH3-dependent DNA alkylation repair and cancer cell proliferation."
      Dango S., Mosammaparast N., Sowa M.E., Xiong L.J., Wu F., Park K., Rubin M., Gygi S., Harper J.W., Shi Y.
      Mol. Cell 44:373-384(2011) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, CATALYTIC ACTIVITY, INTERACTION WITH ALKBH3, MUTAGENESIS OF GLY-1354.

    Entry informationi

    Entry nameiASCC3_HUMAN
    AccessioniPrimary (citable) accession number: Q8N3C0
    Secondary accession number(s): E7EW23
    , O43738, Q4G1A0, Q5VTN2, Q9H1I9, Q9H5A2, Q9NTR0
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: July 19, 2004
    Last sequence update: September 11, 2007
    Last modified: October 1, 2014
    This is version 125 of the entry and version 3 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Direct protein sequencing, Reference proteome

    Documents

    1. Human chromosome 6
      Human chromosome 6: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3