Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Activating signal cointegrator 1 complex subunit 3

Gene

ASCC3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

3'-5' DNA helicase involved in repair of alkylated DNA. Promotes DNA unwinding to generate single-stranded substrate needed for ALKBH3, enabling ALKBH3 to process alkylated N3-methylcytosine (3mC) within double-stranded regions. Enhances NF-kappa-B, SRF and AP1 transactivation.1 Publication

Catalytic activityi

ATP + H2O = ADP + phosphate.1 Publication

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Nucleotide bindingi499 – 506ATPPROSITE-ProRule annotation8
Nucleotide bindingi1349 – 1356ATPPROSITE-ProRule annotation8

GO - Molecular functioni

  • ATP binding Source: UniProtKB-KW
  • ATP-dependent 3'-5' DNA helicase activity Source: UniProtKB
  • poly(A) RNA binding Source: UniProtKB

GO - Biological processi

  • cell proliferation Source: UniProtKB
  • DNA dealkylation involved in DNA repair Source: UniProtKB
  • DNA duplex unwinding Source: UniProtKB
  • regulation of transcription, DNA-templated Source: UniProtKB-KW
  • transcription, DNA-templated Source: UniProtKB-KW
Complete GO annotation...

Keywords - Molecular functioni

Helicase, Hydrolase

Keywords - Biological processi

DNA damage, DNA repair, Transcription, Transcription regulation

Keywords - Ligandi

ATP-binding, Nucleotide-binding

Enzyme and pathway databases

BioCyciZFISH:ENSG00000112249-MONOMER.
ReactomeiR-HSA-112126. ALKBH3 mediated reversal of alkylation damage.

Names & Taxonomyi

Protein namesi
Recommended name:
Activating signal cointegrator 1 complex subunit 3 (EC:3.6.4.12)
Alternative name(s):
ASC-1 complex subunit p200
Short name:
ASC1p200
Helicase, ATP binding 1
Trip4 complex subunit p200
Gene namesi
Name:ASCC3
Synonyms:HELIC1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 6

Organism-specific databases

HGNCiHGNC:18697. ASCC3.

Subcellular locationi

GO - Cellular componenti

  • activating signal cointegrator 1 complex Source: UniProtKB
  • cytoplasm Source: HPA
  • Golgi apparatus Source: HPA
  • intracellular Source: LIFEdb
  • membrane Source: UniProtKB
  • nucleoplasm Source: Reactome
  • nucleus Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi1354G → D: Abolishes 3'-5' DNA helicase activity and ability to promote DNA repair. 1 Publication1

Organism-specific databases

DisGeNETi10973.
OpenTargetsiENSG00000112249.
PharmGKBiPA134890913.

Polymorphism and mutation databases

BioMutaiASCC3.
DMDMi158518649.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001020931 – 2202Activating signal cointegrator 1 complex subunit 3Add BLAST2202

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei12PhosphoserineCombined sources1
Modified residuei572N6-acetyllysineCombined sources1
Modified residuei2195PhosphoserineCombined sources1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

EPDiQ8N3C0.
MaxQBiQ8N3C0.
PaxDbiQ8N3C0.
PeptideAtlasiQ8N3C0.
PRIDEiQ8N3C0.

PTM databases

iPTMnetiQ8N3C0.
PhosphoSitePlusiQ8N3C0.

Expressioni

Tissue specificityi

Ubiquitous.

Gene expression databases

BgeeiENSG00000112249.
CleanExiHS_ASCC3.
ExpressionAtlasiQ8N3C0. baseline and differential.
GenevisibleiQ8N3C0. HS.

Organism-specific databases

HPAiHPA031608.
HPA031609.
HPA031610.

Interactioni

Subunit structurei

Part of the ASC-1/TRIP4 complex, that contains TRIP4, ASCC1, ASCC2 and ASCC3. The ASC-1 complex interacts with ALKBH3.2 Publications

Protein-protein interaction databases

BioGridi116170. 32 interactors.
IntActiQ8N3C0. 15 interactors.
MINTiMINT-1183138.
STRINGi9606.ENSP00000358159.

Structurei

3D structure databases

ProteinModelPortaliQ8N3C0.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini486 – 669Helicase ATP-binding 1PROSITE-ProRule annotationAdd BLAST184
Domaini728 – 914Helicase C-terminal 1PROSITE-ProRule annotationAdd BLAST187
Domaini978 – 1287SEC63 1Add BLAST310
Domaini1336 – 1511Helicase ATP-binding 2PROSITE-ProRule annotationAdd BLAST176
Domaini1544 – 1739Helicase C-terminal 2PROSITE-ProRule annotationAdd BLAST196
Domaini1812 – 2176SEC63 2Add BLAST365

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili18 – 79Sequence analysisAdd BLAST62
Coiled coili328 – 356Sequence analysisAdd BLAST29

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi611 – 614DEVH box4
Motifi1453 – 1456DEIH box4

Sequence similaritiesi

Belongs to the helicase family.Curated
Contains 2 helicase ATP-binding domains.PROSITE-ProRule annotation
Contains 2 helicase C-terminal domains.PROSITE-ProRule annotation
Contains 2 SEC63 domains.Curated

Keywords - Domaini

Coiled coil, Repeat

Phylogenomic databases

eggNOGiKOG0952. Eukaryota.
COG1204. LUCA.
GeneTreeiENSGT00640000091272.
HOGENOMiHOG000169284.
HOVERGENiHBG051896.
InParanoidiQ8N3C0.
KOiK18663.
OMAiFLRVNPM.
OrthoDBiEOG091G0HE5.
PhylomeDBiQ8N3C0.
TreeFamiTF105778.

Family and domain databases

Gene3Di2.60.40.150. 1 hit.
3.40.50.300. 4 hits.
InterProiIPR003593. AAA+_ATPase.
IPR000008. C2_dom.
IPR011545. DEAD/DEAH_box_helicase_dom.
IPR014001. Helicase_ATP-bd.
IPR001650. Helicase_C.
IPR014756. Ig_E-set.
IPR027417. P-loop_NTPase.
IPR004179. Sec63-dom.
IPR011991. WHTH_DNA-bd_dom.
[Graphical view]
PfamiPF00270. DEAD. 2 hits.
PF00271. Helicase_C. 2 hits.
PF02889. Sec63. 2 hits.
[Graphical view]
SMARTiSM00382. AAA. 2 hits.
SM00487. DEXDc. 2 hits.
SM00490. HELICc. 2 hits.
SM00973. Sec63. 2 hits.
[Graphical view]
SUPFAMiSSF46785. SSF46785. 2 hits.
SSF52540. SSF52540. 4 hits.
SSF81296. SSF81296. 1 hit.
PROSITEiPS51192. HELICASE_ATP_BIND_1. 2 hits.
PS51194. HELICASE_CTER. 2 hits.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8N3C0-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MALPRLTGAL RSFSNVTKQD NYNEEVADLK IKRSKLHEQV LDLGLTWKKI
60 70 80 90 100
IKFLNEKLEK SKMQSINEDL KDILHAAKQI VGTDNGREAI ESGAAFLFMT
110 120 130 140 150
FHLKDSVGHK ETKAIKQMFG PFPSSSATAA CNATNRIISH FSQDDLTALV
160 170 180 190 200
QMTEKEHGDR VFFGKNLAFS FDMHDLDHFD ELPINGETQK TISLDYKKFL
210 220 230 240 250
NEHLQEACTP ELKPVEKTNG SFLWCEVEKY LNSTLKEMTE VPRVEDLCCT
260 270 280 290 300
LYDMLASIKS GDELQDELFE LLGPEGLELI EKLLQNRITI VDRFLNSSND
310 320 330 340 350
HRFQALQDNC KKILGENAKP NYGCQVTIQS EQEKQLMKQY RREEKRIARR
360 370 380 390 400
EKKAGEDLEV SEGLMCFDPK ELRIQREQAL LNARSVPILS RQRDADVEKI
410 420 430 440 450
HYPHVYDSQA EAMKTSAFIA GAKMILPEGI QRENNKLYEE VRIPYSEPMP
460 470 480 490 500
LSFEEKPVYI QDLDEIGQLA FKGMKRLNRI QSIVFETAYN TNENMLICAP
510 520 530 540 550
TGAGKTNIAM LTVLHEIRQH FQQGVIKKNE FKIVYVAPMK ALAAEMTDYF
560 570 580 590 600
SRRLEPLGII VKELTGDMQL SKSEILRTQM LVTTPEKWDV VTRKSVGDVA
610 620 630 640 650
LSQIVRLLIL DEVHLLHEDR GPVLESIVAR TLRQVESTQS MIRILGLSAT
660 670 680 690 700
LPNYLDVATF LHVNPYIGLF FFDGRFRPVP LGQTFLGIKC ANKMQQLNNM
710 720 730 740 750
DEVCYENVLK QVKAGHQVMV FVHARNATVR TAMSLIERAK NCGHIPFFFP
760 770 780 790 800
TQGHDYVLAE KQVQRSRNKQ VRELFPDGFS IHHAGMLRQD RNLVENLFSN
810 820 830 840 850
GHIKVLVCTA TLAWGVNLPA HAVIIKGTQI YAAKRGSFVD LGILDVMQIF
860 870 880 890 900
GRAGRPQFDK FGEGIIITTH DKLSHYLTLL TQRNPIESQF LESLADNLNA
910 920 930 940 950
EIALGTVTNV EEAVKWISYT YLYVRMRANP LAYGISHKAY QIDPTLRKHR
960 970 980 990 1000
EQLVIEVGRK LDKAQMIRFE ERTGYFSSTD LGRTASHYYI KYNTIETFNE
1010 1020 1030 1040 1050
LFDAHKTEGD IFAIVSKAEE FDQIKVREEE IEELDTLLSN FCELSTPGGV
1060 1070 1080 1090 1100
ENSYGKINIL LQTYISRGEM DSFSLISDSA YVAQNAARIV RALFEIALRK
1110 1120 1130 1140 1150
RWPTMTYRLL NLSKVIDKRL WGWASPLRQF SILPPHILTR LEEKKLTVDK
1160 1170 1180 1190 1200
LKDMRKDEIG HILHHVNIGL KVKQCVHQIP SVMMEASIQP ITRTVLRVTL
1210 1220 1230 1240 1250
SIYADFTWND QVHGTVGEPW WIWVEDPTND HIYHSEYFLA LKKQVISKEA
1260 1270 1280 1290 1300
QLLVFTIPIF EPLPSQYYIR AVSDRWLGAE AVCIINFQHL ILPERHPPHT
1310 1320 1330 1340 1350
ELLDLQPLPI TALGCKAYEA LYNFSHFNPV QTQIFHTLYH TDCNVLLGAP
1360 1370 1380 1390 1400
TGSGKTVAAE LAIFRVFNKY PTSKAVYIAP LKALVRERMD DWKVRIEEKL
1410 1420 1430 1440 1450
GKKVIELTGD VTPDMKSIAK ADLIVTTPEK WDGVSRSWQN RNYVQQVTIL
1460 1470 1480 1490 1500
IIDEIHLLGE ERGPVLEVIV SRTNFISSHT EKPVRIVGLS TALANARDLA
1510 1520 1530 1540 1550
DWLNIKQMGL FNFRPSVRPV PLEVHIQGFP GQHYCPRMAS MNKPAFQAIR
1560 1570 1580 1590 1600
SHSPAKPVLI FVSSRRQTRL TALELIAFLA TEEDPKQWLN MDEREMENII
1610 1620 1630 1640 1650
ATVRDSNLKL TLAFGIGMHH AGLHERDRKT VEELFVNCKV QVLIATSTLA
1660 1670 1680 1690 1700
WGVNFPAHLV IIKGTEYYDG KTRRYVDFPI TDVLQMMGRA GRPQFDDQGK
1710 1720 1730 1740 1750
AVILVHDIKK DFYKKFLYEP FPVESSLLGV LSDHLNAEIA GGTITSKQDA
1760 1770 1780 1790 1800
LDYITWTYFF RRLIMNPSYY NLGDVSHDSV NKFLSHLIEK SLIELELSYC
1810 1820 1830 1840 1850
IEIGEDNRSI EPLTYGRIAS YYYLKHQTVK MFKDRLKPEC STEELLSILS
1860 1870 1880 1890 1900
DAEEYTDLPV RHNEDHMNSE LAKCLPIESN PHSFDSPHTK AHLLLQAHLS
1910 1920 1930 1940 1950
RAMLPCPDYD TDTKTVLDQA LRVCQAMLDV AANQGWLVTV LNITNLIQMV
1960 1970 1980 1990 2000
IQGRWLKDSS LLTLPNIENH HLHLFKKWKP IMKGPHARGR TSIESLPELI
2010 2020 2030 2040 2050
HACGGKDHVF SSMVESELHA AKTKQAWNFL SHLPVINVGI SVKGSWDDLV
2060 2070 2080 2090 2100
EGHNELSVST LTADKRDDNK WIKLHADQEY VLQVSLQRVH FGFHKGKPES
2110 2120 2130 2140 2150
CAVTPRFPKS KDEGWFLILG EVDKRELIAL KRVGYIRNHH VASLSFYTPE
2160 2170 2180 2190 2200
IPGRYIYTLY FMSDCYLGLD QQYDIYLNVT QASLSAQVNT KVSDSLTDLA

LK
Length:2,202
Mass (Da):251,460
Last modified:September 11, 2007 - v3
Checksum:i9F074E6E5853399C
GO
Isoform 2 (identifier: Q8N3C0-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     81-111: VGTDNGREAIESGAAFLFMTFHLKDSVGHKE → EVNCPFQKRRLDGKEEDEKMSRASDRFRGLR
     112-2202: Missing.

Show »
Length:111
Mass (Da):13,014
Checksum:iF3D84693464682F3
GO
Isoform 3 (identifier: Q8N3C0-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     719-731: MVFVHARNATVRT → HLFYLLLHLFICF
     732-2202: Missing.

Show »
Length:731
Mass (Da):83,675
Checksum:iE82CDB32BEC21AF3
GO

Sequence cautioni

The sequence AAG45474 differs from that shown. Reason: Frameshift at position 2175.Curated
The sequence CAA11679 differs from that shown. Reason: Frameshift at position 2175.Curated
The sequence CAA11679 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti86G → E in AAH26066 (PubMed:15489334).Curated1
Sequence conflicti269 – 277Missing in CAH73862 (PubMed:14702039).Curated9
Sequence conflicti269 – 277Missing in CAI16190 (PubMed:14702039).Curated9
Sequence conflicti269 – 277Missing in CAI19454 (PubMed:14702039).Curated9
Sequence conflicti269 – 277Missing in CAI19627 (PubMed:14702039).Curated9
Sequence conflicti269 – 277Missing in CAI21439 (PubMed:14702039).Curated9
Sequence conflicti444P → S in CAD39122 (PubMed:17974005).Curated1
Sequence conflicti582V → A in AAH26066 (PubMed:15489334).Curated1
Sequence conflicti750P → S in CAD39122 (PubMed:17974005).Curated1
Sequence conflicti1187S → F in CAA11679 (Ref. 7) Curated1
Sequence conflicti1343C → S in CAA11679 (Ref. 7) Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_034859146L → F.1 PublicationCorresponds to variant rs9390698dbSNPEnsembl.1
Natural variantiVAR_049339344E → K.Corresponds to variant rs6918004dbSNPEnsembl.1
Natural variantiVAR_049340478N → S.Corresponds to variant rs7750940dbSNPEnsembl.1
Natural variantiVAR_0612121016S → C.Corresponds to variant rs57534235dbSNPEnsembl.1
Natural variantiVAR_0348601050V → I.Corresponds to variant rs9497983dbSNPEnsembl.1
Natural variantiVAR_0493411425V → A.Corresponds to variant rs17246013dbSNPEnsembl.1
Natural variantiVAR_0493421497R → T.Corresponds to variant rs17305382dbSNPEnsembl.1
Natural variantiVAR_0348611800C → W.Corresponds to variant rs35011147dbSNPEnsembl.1
Natural variantiVAR_0348621930V → M.Corresponds to variant rs3213542dbSNPEnsembl.1
Natural variantiVAR_0348631995S → C.2 PublicationsCorresponds to variant rs240780dbSNPEnsembl.1
Natural variantiVAR_0348642176Y → C.Corresponds to variant rs240768dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_04295581 – 111VGTDN…VGHKE → EVNCPFQKRRLDGKEEDEKM SRASDRFRGLR in isoform 2. 2 PublicationsAdd BLAST31
Alternative sequenceiVSP_042956112 – 2202Missing in isoform 2. 2 PublicationsAdd BLAST2091
Alternative sequenceiVSP_042957719 – 731MVFVH…ATVRT → HLFYLLLHLFICF in isoform 3. 1 PublicationAdd BLAST13
Alternative sequenceiVSP_042958732 – 2202Missing in isoform 3. 1 PublicationAdd BLAST1471

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AL834463 mRNA. Translation: CAD39122.1.
AK315197 mRNA. Translation: BAG37637.1.
AL591585
, AL121965, AL133338, AL356122, Z86062 Genomic DNA. Translation: CAH73862.1.
AL356122
, AL121965, AL133338, AL591585, Z86062 Genomic DNA. Translation: CAI16190.1.
Z86062
, AL121965, AL133338, AL356122, AL591585 Genomic DNA. Translation: CAI19454.1.
AL121965
, AL133338, AL356122, AL591585, Z86062 Genomic DNA. Translation: CAI19627.1.
AL133338
, AL121965, AL356122, AL591585, Z86062 Genomic DNA. Translation: CAI21439.1.
AL133338 Genomic DNA. Translation: CAC07337.1.
CH471051 Genomic DNA. Translation: EAW48449.1.
BC050681 mRNA. Translation: AAH50681.1.
BC125211 mRNA. Translation: AAI25212.1.
BC125212 mRNA. Translation: AAI25213.1.
BC026066 mRNA. Translation: AAH26066.1.
AY013288 mRNA. Translation: AAG45474.1. Frameshift.
AJ223948 mRNA. Translation: CAA11679.1. Sequence problems.
CCDSiCCDS5046.1. [Q8N3C0-1]
CCDS5047.1. [Q8N3C0-3]
CCDS75497.1. [Q8N3C0-4]
RefSeqiNP_001271200.1. NM_001284271.1. [Q8N3C0-4]
NP_006819.2. NM_006828.3. [Q8N3C0-1]
NP_071374.1. NM_022091.4. [Q8N3C0-3]
UniGeneiHs.486031.
Hs.733060.

Genome annotation databases

EnsembliENST00000369143; ENSP00000358139; ENSG00000112249. [Q8N3C0-3]
ENST00000369162; ENSP00000358159; ENSG00000112249. [Q8N3C0-1]
ENST00000522650; ENSP00000430769; ENSG00000112249. [Q8N3C0-4]
GeneIDi10973.
KEGGihsa:10973.
UCSCiuc003pqk.5. human. [Q8N3C0-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AL834463 mRNA. Translation: CAD39122.1.
AK315197 mRNA. Translation: BAG37637.1.
AL591585
, AL121965, AL133338, AL356122, Z86062 Genomic DNA. Translation: CAH73862.1.
AL356122
, AL121965, AL133338, AL591585, Z86062 Genomic DNA. Translation: CAI16190.1.
Z86062
, AL121965, AL133338, AL356122, AL591585 Genomic DNA. Translation: CAI19454.1.
AL121965
, AL133338, AL356122, AL591585, Z86062 Genomic DNA. Translation: CAI19627.1.
AL133338
, AL121965, AL356122, AL591585, Z86062 Genomic DNA. Translation: CAI21439.1.
AL133338 Genomic DNA. Translation: CAC07337.1.
CH471051 Genomic DNA. Translation: EAW48449.1.
BC050681 mRNA. Translation: AAH50681.1.
BC125211 mRNA. Translation: AAI25212.1.
BC125212 mRNA. Translation: AAI25213.1.
BC026066 mRNA. Translation: AAH26066.1.
AY013288 mRNA. Translation: AAG45474.1. Frameshift.
AJ223948 mRNA. Translation: CAA11679.1. Sequence problems.
CCDSiCCDS5046.1. [Q8N3C0-1]
CCDS5047.1. [Q8N3C0-3]
CCDS75497.1. [Q8N3C0-4]
RefSeqiNP_001271200.1. NM_001284271.1. [Q8N3C0-4]
NP_006819.2. NM_006828.3. [Q8N3C0-1]
NP_071374.1. NM_022091.4. [Q8N3C0-3]
UniGeneiHs.486031.
Hs.733060.

3D structure databases

ProteinModelPortaliQ8N3C0.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi116170. 32 interactors.
IntActiQ8N3C0. 15 interactors.
MINTiMINT-1183138.
STRINGi9606.ENSP00000358159.

PTM databases

iPTMnetiQ8N3C0.
PhosphoSitePlusiQ8N3C0.

Polymorphism and mutation databases

BioMutaiASCC3.
DMDMi158518649.

Proteomic databases

EPDiQ8N3C0.
MaxQBiQ8N3C0.
PaxDbiQ8N3C0.
PeptideAtlasiQ8N3C0.
PRIDEiQ8N3C0.

Protocols and materials databases

DNASUi10973.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000369143; ENSP00000358139; ENSG00000112249. [Q8N3C0-3]
ENST00000369162; ENSP00000358159; ENSG00000112249. [Q8N3C0-1]
ENST00000522650; ENSP00000430769; ENSG00000112249. [Q8N3C0-4]
GeneIDi10973.
KEGGihsa:10973.
UCSCiuc003pqk.5. human. [Q8N3C0-1]

Organism-specific databases

CTDi10973.
DisGeNETi10973.
GeneCardsiASCC3.
H-InvDBHIX0021958.
HGNCiHGNC:18697. ASCC3.
HPAiHPA031608.
HPA031609.
HPA031610.
MIMi614217. gene.
neXtProtiNX_Q8N3C0.
OpenTargetsiENSG00000112249.
PharmGKBiPA134890913.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0952. Eukaryota.
COG1204. LUCA.
GeneTreeiENSGT00640000091272.
HOGENOMiHOG000169284.
HOVERGENiHBG051896.
InParanoidiQ8N3C0.
KOiK18663.
OMAiFLRVNPM.
OrthoDBiEOG091G0HE5.
PhylomeDBiQ8N3C0.
TreeFamiTF105778.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000112249-MONOMER.
ReactomeiR-HSA-112126. ALKBH3 mediated reversal of alkylation damage.

Miscellaneous databases

ChiTaRSiASCC3. human.
GeneWikiiASCC3.
GenomeRNAii10973.
PROiQ8N3C0.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000112249.
CleanExiHS_ASCC3.
ExpressionAtlasiQ8N3C0. baseline and differential.
GenevisibleiQ8N3C0. HS.

Family and domain databases

Gene3Di2.60.40.150. 1 hit.
3.40.50.300. 4 hits.
InterProiIPR003593. AAA+_ATPase.
IPR000008. C2_dom.
IPR011545. DEAD/DEAH_box_helicase_dom.
IPR014001. Helicase_ATP-bd.
IPR001650. Helicase_C.
IPR014756. Ig_E-set.
IPR027417. P-loop_NTPase.
IPR004179. Sec63-dom.
IPR011991. WHTH_DNA-bd_dom.
[Graphical view]
PfamiPF00270. DEAD. 2 hits.
PF00271. Helicase_C. 2 hits.
PF02889. Sec63. 2 hits.
[Graphical view]
SMARTiSM00382. AAA. 2 hits.
SM00487. DEXDc. 2 hits.
SM00490. HELICc. 2 hits.
SM00973. Sec63. 2 hits.
[Graphical view]
SUPFAMiSSF46785. SSF46785. 2 hits.
SSF52540. SSF52540. 4 hits.
SSF81296. SSF81296. 1 hit.
PROSITEiPS51192. HELICASE_ATP_BIND_1. 2 hits.
PS51194. HELICASE_CTER. 2 hits.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiASCC3_HUMAN
AccessioniPrimary (citable) accession number: Q8N3C0
Secondary accession number(s): E7EW23
, O43738, Q4G1A0, Q5VTN2, Q9H1I9, Q9H5A2, Q9NTR0
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 19, 2004
Last sequence update: September 11, 2007
Last modified: November 2, 2016
This is version 146 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 6
    Human chromosome 6: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.