Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Large neutral amino acids transporter small subunit 4

Gene

SLC43A2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Sodium-, chloride-, and pH-independent high affinity transport of large neutral amino acids.1 Publication

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

Amino-acid transport, Transport

Enzyme and pathway databases

ReactomeiR-HSA-352230. Amino acid transport across the plasma membrane.

Protein family/group databases

TCDBi2.A.1.44.2. the major facilitator superfamily (mfs).

Names & Taxonomyi

Protein namesi
Recommended name:
Large neutral amino acids transporter small subunit 4
Alternative name(s):
L-type amino acid transporter 4
Solute carrier family 43 member 2
Gene namesi
Name:SLC43A2
Synonyms:LAT4
ORF Names:PP7664
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 17

Organism-specific databases

HGNCiHGNC:23087. SLC43A2.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transmembranei20 – 4021HelicalSequence analysisAdd
BLAST
Transmembranei90 – 11021HelicalSequence analysisAdd
BLAST
Transmembranei120 – 14021HelicalSequence analysisAdd
BLAST
Transmembranei143 – 16321HelicalSequence analysisAdd
BLAST
Transmembranei177 – 19721HelicalSequence analysisAdd
BLAST
Transmembranei203 – 22321HelicalSequence analysisAdd
BLAST
Transmembranei323 – 34523HelicalSequence analysisAdd
BLAST
Transmembranei365 – 38521HelicalSequence analysisAdd
BLAST
Transmembranei435 – 45521HelicalSequence analysisAdd
BLAST
Transmembranei462 – 48221HelicalSequence analysisAdd
BLAST
Transmembranei490 – 51021HelicalSequence analysisAdd
BLAST
Transmembranei516 – 53621HelicalSequence analysisAdd
BLAST

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi297 – 2971S → A: Abolishes sensitivity to N-ethymaleimide. 1 Publication

Organism-specific databases

PharmGKBiPA134940765.

Polymorphism and mutation databases

DMDMi74728779.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 569569Large neutral amino acids transporter small subunit 4PRO_0000307272Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi55 – 551N-linked (GlcNAc...)Sequence analysis
Glycosylationi58 – 581N-linked (GlcNAc...)Sequence analysis
Modified residuei274 – 2741PhosphoserineCombined sources
Modified residuei278 – 2781PhosphoserineCombined sources
Modified residuei297 – 2971PhosphoserineCombined sources
Glycosylationi560 – 5601N-linked (GlcNAc...)Sequence analysis

Post-translational modificationi

Glycosylated.By similarity

Keywords - PTMi

Glycoprotein, Phosphoprotein

Proteomic databases

MaxQBiQ8N370.
PaxDbiQ8N370.
PeptideAtlasiQ8N370.
PRIDEiQ8N370.

PTM databases

iPTMnetiQ8N370.
PhosphoSiteiQ8N370.

Expressioni

Tissue specificityi

Detected in several tissues with higher expression in placenta, kidney and peripheral blood leukocytes. In the kidney, is detected in epithelial cells of the distal tubule and collecting duct. In the intestine, is expressed mainly in crypt cells of the intestinal microvilli and epithelial cells in the base of the villus.1 Publication

Gene expression databases

BgeeiQ8N370.
CleanExiHS_SLC43A2.
ExpressionAtlasiQ8N370. baseline and differential.
GenevisibleiQ8N370. HS.

Organism-specific databases

HPAiHPA021564.

Interactioni

Protein-protein interaction databases

BioGridi125901. 3 interactions.
MINTiMINT-4724578.
STRINGi9606.ENSP00000301335.

Structurei

3D structure databases

ProteinModelPortaliQ8N370.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi409 – 4135Poly-Lys

Sequence similaritiesi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410IHJQ. Eukaryota.
ENOG410XS1N. LUCA.
GeneTreeiENSGT00530000063043.
HOGENOMiHOG000231937.
HOVERGENiHBG072879.
InParanoidiQ8N370.
KOiK08229.
OMAiWRLKECD.
OrthoDBiEOG712TWX.
PhylomeDBiQ8N370.
TreeFamiTF328358.

Family and domain databases

InterProiIPR027201. LAT4.
IPR011701. MFS.
IPR020846. MFS_dom.
[Graphical view]
PANTHERiPTHR20766:SF2. PTHR20766:SF2. 1 hit.
PfamiPF07690. MFS_1. 1 hit.
[Graphical view]
SUPFAMiSSF103473. SSF103473. 3 hits.

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8N370-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAPTLATAHR RRWWMACTAV LENLLFSAVL LGWGSLLIML KSEGFYSYLC
60 70 80 90 100
TEPENVTNGT VGGTAEPGHE EVSWMNGWLS CQAQDEMLNL AFTVGSFLLS
110 120 130 140 150
AITLPLGIVM DKYGPRKLRL LGSACFAVSC LLIAYGASKP NALSVLIFIA
160 170 180 190 200
LALNGFGGMC MTFTSLTLPN MFGDLRSTFI ALMIGSYASS AVTFPGIKLI
210 220 230 240 250
YDAGVSFIVV LVVWAGCSGL VFLNCFFNWP LEPFPGPEDM DYSVKIKFSW
260 270 280 290 300
LGFDHKITGK QFYKQVTTVG RRLSVGSSMR SAKEQVALQE GHKLCLSTVD
310 320 330 340 350
LEVKCQPDAA VAPSFMHSVF SPILLLSLVT MCVTQLRLIF YMGAMNNILK
360 370 380 390 400
FLVSGDQKTV GLYTSIFGVL QLLCLLTAPV IGYIMDWRLK ECEDASEEPE
410 420 430 440 450
EKDANQGEKK KKKRDRQIQK ITNAMRAFAF TNLLLVGFGV TCLIPNLPLQ
460 470 480 490 500
ILSFILHTIV RGFIHSAVGG LYAAVYPSTQ FGSLTGLQSL ISALFALLQQ
510 520 530 540 550
PLFLAMMGPL QGDPLWVNVG LLLLSLLGFC LPLYLICYRR QLERQLQQRQ
560
EDDKLFLKIN GSSNQEAFV
Length:569
Mass (Da):62,747
Last modified:October 1, 2002 - v1
Checksum:i86C4BB53FF849881
GO
Isoform 2 (identifier: Q8N370-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     407-489: GEKKKKKRDR...QFGSLTGLQS → CVGRAGAPAP...FEARCGDSCL
     490-569: Missing.

Show »
Length:489
Mass (Da):53,344
Checksum:i6FFA5A1280F6B54E
GO
Isoform 3 (identifier: Q8N370-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     358-358: K → KTVMA

Show »
Length:573
Mass (Da):63,149
Checksum:i26FABB553F50ED2F
GO
Isoform 4 (identifier: Q8N370-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-30: MAPTLATAHRRRWWMACTAVLENLLFSAVL → MTYGSPQANASPSDAVALDHGEVSRRQQQE
     31-167: Missing.

Note: No experimental confirmation available.
Show »
Length:432
Mass (Da):47,968
Checksum:i56B087649F6F3028
GO

Sequence cautioni

The sequence BAC11383.1 differs from that shown. Reason: Erroneous initiation. Curated
The sequence BAC11450.1 differs from that shown. Reason: Erroneous initiation. Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti19 – 191A → P in AAL55776 (PubMed:15498874).Curated
Sequence conflicti254 – 2541D → N in BAC11383 (PubMed:14702039).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 3030MAPTL…FSAVL → MTYGSPQANASPSDAVALDH GEVSRRQQQE in isoform 4. 1 PublicationVSP_055373Add
BLAST
Alternative sequencei31 – 167137Missing in isoform 4. 1 PublicationVSP_055374Add
BLAST
Alternative sequencei358 – 3581K → KTVMA in isoform 3. 1 PublicationVSP_028664
Alternative sequencei407 – 48983GEKKK…TGLQS → CVGRAGAPAPSPQPLQKDPR AACQAQGGWDRGREQCTPAP PGALRETHSFSSACVSTAPL FMEIVWNAMEMLKFEARCGD SCL in isoform 2. 2 PublicationsVSP_028665Add
BLAST
Alternative sequencei490 – 56980Missing in isoform 2. 2 PublicationsVSP_028666Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
BK005642 mRNA. Translation: DAA05676.1.
AB120364 mRNA. Translation: BAD91091.1.
AK075068 mRNA. Translation: BAC11383.1. Different initiation.
AK075173 mRNA. Translation: BAC11450.1. Different initiation.
AK301127 mRNA. Translation: BAH13415.1.
AF289592 mRNA. Translation: AAL55776.1.
AC100748 Genomic DNA. No translation available.
AC130343 Genomic DNA. No translation available.
CH471108 Genomic DNA. Translation: EAW90602.1.
CH471108 Genomic DNA. Translation: EAW90604.1.
CH471108 Genomic DNA. Translation: EAW90605.1.
CH471108 Genomic DNA. Translation: EAW90607.1.
BC027923 mRNA. Translation: AAH27923.1.
BC071859 mRNA. Translation: AAH71859.1.
CCDSiCCDS11006.1. [Q8N370-1]
CCDS67107.1. [Q8N370-4]
CCDS67108.1. [Q8N370-3]
RefSeqiNP_001271427.1. NM_001284498.1. [Q8N370-3]
NP_001271428.1. NM_001284499.1. [Q8N370-4]
NP_001308293.1. NM_001321364.1. [Q8N370-3]
NP_001308294.1. NM_001321365.1. [Q8N370-3]
NP_689559.1. NM_152346.2. [Q8N370-1]
UniGeneiHs.160550.
Hs.656337.
Hs.732271.

Genome annotation databases

EnsembliENST00000301335; ENSP00000301335; ENSG00000167703. [Q8N370-1]
ENST00000382147; ENSP00000371582; ENSG00000278550. [Q8N370-4]
ENST00000412517; ENSP00000408284; ENSG00000167703. [Q8N370-4]
ENST00000571650; ENSP00000461382; ENSG00000167703. [Q8N370-3]
ENST00000612931; ENSP00000483848; ENSG00000278550. [Q8N370-3]
ENST00000613070; ENSP00000484291; ENSG00000278550. [Q8N370-3]
ENST00000634102; ENSP00000488355; ENSG00000278550. [Q8N370-1]
GeneIDi124935.
KEGGihsa:124935.
UCSCiuc002fsu.5. human. [Q8N370-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
BK005642 mRNA. Translation: DAA05676.1.
AB120364 mRNA. Translation: BAD91091.1.
AK075068 mRNA. Translation: BAC11383.1. Different initiation.
AK075173 mRNA. Translation: BAC11450.1. Different initiation.
AK301127 mRNA. Translation: BAH13415.1.
AF289592 mRNA. Translation: AAL55776.1.
AC100748 Genomic DNA. No translation available.
AC130343 Genomic DNA. No translation available.
CH471108 Genomic DNA. Translation: EAW90602.1.
CH471108 Genomic DNA. Translation: EAW90604.1.
CH471108 Genomic DNA. Translation: EAW90605.1.
CH471108 Genomic DNA. Translation: EAW90607.1.
BC027923 mRNA. Translation: AAH27923.1.
BC071859 mRNA. Translation: AAH71859.1.
CCDSiCCDS11006.1. [Q8N370-1]
CCDS67107.1. [Q8N370-4]
CCDS67108.1. [Q8N370-3]
RefSeqiNP_001271427.1. NM_001284498.1. [Q8N370-3]
NP_001271428.1. NM_001284499.1. [Q8N370-4]
NP_001308293.1. NM_001321364.1. [Q8N370-3]
NP_001308294.1. NM_001321365.1. [Q8N370-3]
NP_689559.1. NM_152346.2. [Q8N370-1]
UniGeneiHs.160550.
Hs.656337.
Hs.732271.

3D structure databases

ProteinModelPortaliQ8N370.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi125901. 3 interactions.
MINTiMINT-4724578.
STRINGi9606.ENSP00000301335.

Protein family/group databases

TCDBi2.A.1.44.2. the major facilitator superfamily (mfs).

PTM databases

iPTMnetiQ8N370.
PhosphoSiteiQ8N370.

Polymorphism and mutation databases

DMDMi74728779.

Proteomic databases

MaxQBiQ8N370.
PaxDbiQ8N370.
PeptideAtlasiQ8N370.
PRIDEiQ8N370.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000301335; ENSP00000301335; ENSG00000167703. [Q8N370-1]
ENST00000382147; ENSP00000371582; ENSG00000278550. [Q8N370-4]
ENST00000412517; ENSP00000408284; ENSG00000167703. [Q8N370-4]
ENST00000571650; ENSP00000461382; ENSG00000167703. [Q8N370-3]
ENST00000612931; ENSP00000483848; ENSG00000278550. [Q8N370-3]
ENST00000613070; ENSP00000484291; ENSG00000278550. [Q8N370-3]
ENST00000634102; ENSP00000488355; ENSG00000278550. [Q8N370-1]
GeneIDi124935.
KEGGihsa:124935.
UCSCiuc002fsu.5. human. [Q8N370-1]

Organism-specific databases

CTDi124935.
GeneCardsiSLC43A2.
H-InvDBHIX0017704.
HIX0039573.
HGNCiHGNC:23087. SLC43A2.
HPAiHPA021564.
MIMi610791. gene.
neXtProtiNX_Q8N370.
PharmGKBiPA134940765.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IHJQ. Eukaryota.
ENOG410XS1N. LUCA.
GeneTreeiENSGT00530000063043.
HOGENOMiHOG000231937.
HOVERGENiHBG072879.
InParanoidiQ8N370.
KOiK08229.
OMAiWRLKECD.
OrthoDBiEOG712TWX.
PhylomeDBiQ8N370.
TreeFamiTF328358.

Enzyme and pathway databases

ReactomeiR-HSA-352230. Amino acid transport across the plasma membrane.

Miscellaneous databases

ChiTaRSiSLC43A2. human.
GenomeRNAii124935.
PROiQ8N370.
SOURCEiSearch...

Gene expression databases

BgeeiQ8N370.
CleanExiHS_SLC43A2.
ExpressionAtlasiQ8N370. baseline and differential.
GenevisibleiQ8N370. HS.

Family and domain databases

InterProiIPR027201. LAT4.
IPR011701. MFS.
IPR020846. MFS_dom.
[Graphical view]
PANTHERiPTHR20766:SF2. PTHR20766:SF2. 1 hit.
PfamiPF07690. MFS_1. 1 hit.
[Graphical view]
SUPFAMiSSF103473. SSF103473. 3 hits.
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Identification of LAT4, a novel amino acid transporter with system L activity."
    Bodoy S., Martin L., Zorzano A., Palacin M., Estevez R., Bertran J.
    J. Biol. Chem. 280:12002-12011(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY, FUNCTION, MUTAGENESIS OF SER-297.
  2. "Identification of a human system L2 neutral amino acid transporter in brain."
    Shadi B., Kanai Y., Iribe Y., Chairoungdua A., Babu E., Jutabha P., Li Y., Anzai N., Endou H.
    Submitted (SEP-2003) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3).
    Tissue: Frontal cortex.
  3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 90-569 (ISOFORM 1/2/3).
    Tissue: Placenta and Spleen.
  4. "Large-scale cDNA transfection screening for genes related to cancer development and progression."
    Wan D., Gong Y., Qin W., Zhang P., Li J., Wei L., Zhou X., Li H., Qiu X., Zhong F., He L., Yu J., Yao G., Jiang H., Qian L., Yu Y., Shu H., Chen X.
    , Xu H., Guo M., Pan Z., Chen Y., Ge C., Yang S., Gu J.
    Proc. Natl. Acad. Sci. U.S.A. 101:15724-15729(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
  5. "DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage."
    Zody M.C., Garber M., Adams D.J., Sharpe T., Harrow J., Lupski J.R., Nicholson C., Searle S.M., Wilming L., Young S.K., Abouelleil A., Allen N.R., Bi W., Bloom T., Borowsky M.L., Bugalter B.E., Butler J., Chang J.L.
    , Chen C.-K., Cook A., Corum B., Cuomo C.A., de Jong P.J., DeCaprio D., Dewar K., FitzGerald M., Gilbert J., Gibson R., Gnerre S., Goldstein S., Grafham D.V., Grocock R., Hafez N., Hagopian D.S., Hart E., Norman C.H., Humphray S., Jaffe D.B., Jones M., Kamal M., Khodiyar V.K., LaButti K., Laird G., Lehoczky J., Liu X., Lokyitsang T., Loveland J., Lui A., Macdonald P., Major J.E., Matthews L., Mauceli E., McCarroll S.A., Mihalev A.H., Mudge J., Nguyen C., Nicol R., O'Leary S.B., Osoegawa K., Schwartz D.C., Shaw-Smith C., Stankiewicz P., Steward C., Swarbreck D., Venkataraman V., Whittaker C.A., Yang X., Zimmer A.R., Bradley A., Hubbard T., Birren B.W., Rogers J., Lander E.S., Nusbaum C.
    Nature 440:1045-1049(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  7. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
    Tissue: Brain.
  8. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-274 AND SER-278, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  9. "Toward a comprehensive characterization of a human cancer cell phosphoproteome."
    Zhou H., Di Palma S., Preisinger C., Peng M., Polat A.N., Heck A.J., Mohammed S.
    J. Proteome Res. 12:260-271(2013) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-297, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma and Erythroleukemia.

Entry informationi

Entry nameiLAT4_HUMAN
AccessioniPrimary (citable) accession number: Q8N370
Secondary accession number(s): B7Z6X9
, C9JNU8, D3DTH9, Q5CD75, Q6IPM1, Q8NBX1, Q8NC21, Q8WZ00
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 23, 2007
Last sequence update: October 1, 2002
Last modified: July 6, 2016
This is version 113 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.