Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Large neutral amino acids transporter small subunit 4

Gene

SLC43A2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Sodium-, chloride-, and pH-independent high affinity transport of large neutral amino acids.1 Publication

GO - Molecular functioni

GO - Biological processi

Keywordsi

Biological processAmino-acid transport, Transport

Enzyme and pathway databases

ReactomeiR-HSA-352230 Amino acid transport across the plasma membrane

Protein family/group databases

TCDBi2.A.1.44.2 the major facilitator superfamily (mfs)

Names & Taxonomyi

Protein namesi
Recommended name:
Large neutral amino acids transporter small subunit 4
Alternative name(s):
L-type amino acid transporter 4
Solute carrier family 43 member 2
Gene namesi
Name:SLC43A2
Synonyms:LAT4
ORF Names:PP7664
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 17

Organism-specific databases

EuPathDBiHostDB:ENSG00000167703.14
HGNCiHGNC:23087 SLC43A2
MIMi610791 gene
neXtProtiNX_Q8N370

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Transmembranei20 – 40HelicalSequence analysisAdd BLAST21
Transmembranei90 – 110HelicalSequence analysisAdd BLAST21
Transmembranei120 – 140HelicalSequence analysisAdd BLAST21
Transmembranei143 – 163HelicalSequence analysisAdd BLAST21
Transmembranei177 – 197HelicalSequence analysisAdd BLAST21
Transmembranei203 – 223HelicalSequence analysisAdd BLAST21
Transmembranei323 – 345HelicalSequence analysisAdd BLAST23
Transmembranei365 – 385HelicalSequence analysisAdd BLAST21
Transmembranei435 – 455HelicalSequence analysisAdd BLAST21
Transmembranei462 – 482HelicalSequence analysisAdd BLAST21
Transmembranei490 – 510HelicalSequence analysisAdd BLAST21
Transmembranei516 – 536HelicalSequence analysisAdd BLAST21

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi297S → A: Abolishes sensitivity to N-ethymaleimide. 1 Publication1

Organism-specific databases

DisGeNETi124935
OpenTargetsiENSG00000167703
PharmGKBiPA134940765

Polymorphism and mutation databases

DMDMi74728779

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003072721 – 569Large neutral amino acids transporter small subunit 4Add BLAST569

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi55N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi58N-linked (GlcNAc...) asparagineSequence analysis1
Modified residuei274PhosphoserineCombined sources1
Modified residuei278PhosphoserineCombined sources1
Modified residuei297PhosphoserineCombined sources1
Glycosylationi560N-linked (GlcNAc...) asparagineSequence analysis1

Post-translational modificationi

Glycosylated.By similarity

Keywords - PTMi

Glycoprotein, Phosphoprotein

Proteomic databases

MaxQBiQ8N370
PaxDbiQ8N370
PeptideAtlasiQ8N370
PRIDEiQ8N370

PTM databases

iPTMnetiQ8N370
PhosphoSitePlusiQ8N370

Expressioni

Tissue specificityi

Detected in several tissues with higher expression in placenta, kidney and peripheral blood leukocytes. In the kidney, is detected in epithelial cells of the distal tubule and collecting duct. In the intestine, is expressed mainly in crypt cells of the intestinal microvilli and epithelial cells in the base of the villus.1 Publication

Gene expression databases

BgeeiENSG00000167703
CleanExiHS_SLC43A2
ExpressionAtlasiQ8N370 baseline and differential
GenevisibleiQ8N370 HS

Organism-specific databases

HPAiHPA021564

Interactioni

Binary interactionsi

Show more details

Protein-protein interaction databases

BioGridi125901, 4 interactors
IntActiQ8N370, 4 interactors
STRINGi9606.ENSP00000301335

Structurei

3D structure databases

ProteinModelPortaliQ8N370
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi409 – 413Poly-Lys5

Sequence similaritiesi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410IHJQ Eukaryota
ENOG410XS1N LUCA
GeneTreeiENSGT00530000063043
HOGENOMiHOG000231937
HOVERGENiHBG072879
InParanoidiQ8N370
KOiK08229
OMAiYPSTQFG
OrthoDBiEOG091G0407
PhylomeDBiQ8N370
TreeFamiTF328358

Family and domain databases

CDDicd06174 MFS, 1 hit
InterProiView protein in InterPro
IPR027201 LAT4
IPR011701 MFS
IPR020846 MFS_dom
IPR036259 MFS_trans_sf
PANTHERiPTHR20766:SF2 PTHR20766:SF2, 1 hit
PfamiView protein in Pfam
PF07690 MFS_1, 1 hit
SUPFAMiSSF103473 SSF103473, 3 hits

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8N370-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAPTLATAHR RRWWMACTAV LENLLFSAVL LGWGSLLIML KSEGFYSYLC
60 70 80 90 100
TEPENVTNGT VGGTAEPGHE EVSWMNGWLS CQAQDEMLNL AFTVGSFLLS
110 120 130 140 150
AITLPLGIVM DKYGPRKLRL LGSACFAVSC LLIAYGASKP NALSVLIFIA
160 170 180 190 200
LALNGFGGMC MTFTSLTLPN MFGDLRSTFI ALMIGSYASS AVTFPGIKLI
210 220 230 240 250
YDAGVSFIVV LVVWAGCSGL VFLNCFFNWP LEPFPGPEDM DYSVKIKFSW
260 270 280 290 300
LGFDHKITGK QFYKQVTTVG RRLSVGSSMR SAKEQVALQE GHKLCLSTVD
310 320 330 340 350
LEVKCQPDAA VAPSFMHSVF SPILLLSLVT MCVTQLRLIF YMGAMNNILK
360 370 380 390 400
FLVSGDQKTV GLYTSIFGVL QLLCLLTAPV IGYIMDWRLK ECEDASEEPE
410 420 430 440 450
EKDANQGEKK KKKRDRQIQK ITNAMRAFAF TNLLLVGFGV TCLIPNLPLQ
460 470 480 490 500
ILSFILHTIV RGFIHSAVGG LYAAVYPSTQ FGSLTGLQSL ISALFALLQQ
510 520 530 540 550
PLFLAMMGPL QGDPLWVNVG LLLLSLLGFC LPLYLICYRR QLERQLQQRQ
560
EDDKLFLKIN GSSNQEAFV
Length:569
Mass (Da):62,747
Last modified:October 1, 2002 - v1
Checksum:i86C4BB53FF849881
GO
Isoform 2 (identifier: Q8N370-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     407-489: GEKKKKKRDR...QFGSLTGLQS → CVGRAGAPAP...FEARCGDSCL
     490-569: Missing.

Show »
Length:489
Mass (Da):53,344
Checksum:i6FFA5A1280F6B54E
GO
Isoform 3 (identifier: Q8N370-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     358-358: K → KTVMA

Show »
Length:573
Mass (Da):63,149
Checksum:i26FABB553F50ED2F
GO
Isoform 4 (identifier: Q8N370-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-30: MAPTLATAHRRRWWMACTAVLENLLFSAVL → MTYGSPQANASPSDAVALDHGEVSRRQQQE
     31-167: Missing.

Note: No experimental confirmation available.
Show »
Length:432
Mass (Da):47,968
Checksum:i56B087649F6F3028
GO

Sequence cautioni

The sequence BAC11383 differs from that shown. Reason: Erroneous initiation.Curated
The sequence BAC11450 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti19A → P in AAL55776 (PubMed:15498874).Curated1
Sequence conflicti254D → N in BAC11383 (PubMed:14702039).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0553731 – 30MAPTL…FSAVL → MTYGSPQANASPSDAVALDH GEVSRRQQQE in isoform 4. 1 PublicationAdd BLAST30
Alternative sequenceiVSP_05537431 – 167Missing in isoform 4. 1 PublicationAdd BLAST137
Alternative sequenceiVSP_028664358K → KTVMA in isoform 3. 1 Publication1
Alternative sequenceiVSP_028665407 – 489GEKKK…TGLQS → CVGRAGAPAPSPQPLQKDPR AACQAQGGWDRGREQCTPAP PGALRETHSFSSACVSTAPL FMEIVWNAMEMLKFEARCGD SCL in isoform 2. 2 PublicationsAdd BLAST83
Alternative sequenceiVSP_028666490 – 569Missing in isoform 2. 2 PublicationsAdd BLAST80

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
BK005642 mRNA Translation: DAA05676.1
AB120364 mRNA Translation: BAD91091.1
AK075068 mRNA Translation: BAC11383.1 Different initiation.
AK075173 mRNA Translation: BAC11450.1 Different initiation.
AK301127 mRNA Translation: BAH13415.1
AF289592 mRNA Translation: AAL55776.1
AC100748 Genomic DNA No translation available.
AC130343 Genomic DNA No translation available.
CH471108 Genomic DNA Translation: EAW90602.1
CH471108 Genomic DNA Translation: EAW90604.1
CH471108 Genomic DNA Translation: EAW90605.1
CH471108 Genomic DNA Translation: EAW90607.1
BC027923 mRNA Translation: AAH27923.1
BC071859 mRNA Translation: AAH71859.1
CCDSiCCDS11006.1 [Q8N370-1]
CCDS67107.1 [Q8N370-4]
CCDS67108.1 [Q8N370-3]
RefSeqiNP_001271427.1, NM_001284498.1 [Q8N370-3]
NP_001271428.1, NM_001284499.1 [Q8N370-4]
NP_001308293.1, NM_001321364.1 [Q8N370-3]
NP_001308294.1, NM_001321365.1 [Q8N370-3]
NP_689559.1, NM_152346.2 [Q8N370-1]
XP_016879666.1, XM_017024177.1 [Q8N370-1]
XP_016879667.1, XM_017024178.1 [Q8N370-1]
UniGeneiHs.160550
Hs.656337
Hs.732271

Genome annotation databases

EnsembliENST00000301335; ENSP00000301335; ENSG00000167703 [Q8N370-1]
ENST00000382147; ENSP00000371582; ENSG00000278550 [Q8N370-4]
ENST00000412517; ENSP00000408284; ENSG00000167703 [Q8N370-4]
ENST00000571650; ENSP00000461382; ENSG00000167703 [Q8N370-3]
ENST00000612931; ENSP00000483848; ENSG00000278550 [Q8N370-3]
ENST00000613070; ENSP00000484291; ENSG00000278550 [Q8N370-3]
ENST00000634102; ENSP00000488355; ENSG00000278550 [Q8N370-1]
GeneIDi124935
KEGGihsa:124935
UCSCiuc002fsu.5 human [Q8N370-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiLAT4_HUMAN
AccessioniPrimary (citable) accession number: Q8N370
Secondary accession number(s): B7Z6X9
, C9JNU8, D3DTH9, Q5CD75, Q6IPM1, Q8NBX1, Q8NC21, Q8WZ00
Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 23, 2007
Last sequence update: October 1, 2002
Last modified: March 28, 2018
This is version 126 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

Cookie policy

We would like to use anonymized google analytics cookies to gather statistics on how uniprot.org is used in aggregate. Learn more

UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health