Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q8N2K1

- UB2J2_HUMAN

UniProt

Q8N2K1 - UB2J2_HUMAN

Protein

Ubiquitin-conjugating enzyme E2 J2

Gene

UBE2J2

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 4 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 111 (01 Oct 2014)
      Sequence version 3 (07 Jul 2009)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Catalyzes the covalent attachment of ubiquitin to other proteins. Seems to function in the selective degradation of misfolded membrane proteins from the endoplasmic reticulum (ERAD) By similarity.PROSITE-ProRule annotation

    Catalytic activityi

    ATP + ubiquitin + protein lysine = AMP + diphosphate + protein N-ubiquityllysine.PROSITE-ProRule annotation

    Pathwayi

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Active sitei94 – 941Glycyl thioester intermediatePROSITE-ProRule annotation

    GO - Molecular functioni

    1. acid-amino acid ligase activity Source: InterPro
    2. ATP binding Source: UniProtKB-KW

    GO - Biological processi

    1. protein ubiquitination Source: UniProtKB-UniPathway
    2. response to unfolded protein Source: UniProtKB-KW

    Keywords - Molecular functioni

    Ligase

    Keywords - Biological processi

    Ubl conjugation pathway, Unfolded protein response

    Keywords - Ligandi

    ATP-binding, Nucleotide-binding

    Enzyme and pathway databases

    ReactomeiREACT_75842. Antigen processing: Ubiquitination & Proteasome degradation.
    SignaLinkiQ8N2K1.
    UniPathwayiUPA00143.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Ubiquitin-conjugating enzyme E2 J2 (EC:6.3.2.19)
    Alternative name(s):
    Non-canonical ubiquitin-conjugating enzyme 2
    Short name:
    NCUBE-2
    Gene namesi
    Name:UBE2J2
    Synonyms:NCUBE2
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 1

    Organism-specific databases

    HGNCiHGNC:19268. UBE2J2.

    Subcellular locationi

    GO - Cellular componenti

    1. endoplasmic reticulum membrane Source: UniProtKB-SubCell
    2. integral component of membrane Source: UniProtKB-KW

    Keywords - Cellular componenti

    Endoplasmic reticulum, Membrane

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA134882268.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 259259Ubiquitin-conjugating enzyme E2 J2PRO_0000082596Add
    BLAST

    Proteomic databases

    MaxQBiQ8N2K1.
    PaxDbiQ8N2K1.
    PRIDEiQ8N2K1.

    Expressioni

    Gene expression databases

    ArrayExpressiQ8N2K1.
    BgeeiQ8N2K1.
    CleanExiHS_UBE2J2.
    GenevestigatoriQ8N2K1.

    Organism-specific databases

    HPAiHPA051399.

    Interactioni

    Protein-protein interaction databases

    BioGridi125598. 11 interactions.
    IntActiQ8N2K1. 4 interactions.
    STRINGi9606.ENSP00000383719.

    Structurei

    Secondary structure

    1
    259
    Legend: HelixTurnBeta strand
    Show more details
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Helixi13 – 2614
    Beta strandi32 – 376
    Beta strandi40 – 4910
    Turni55 – 584
    Beta strandi60 – 667
    Turni69 – 724
    Beta strandi77 – 804
    Beta strandi85 – 873
    Helixi111 – 12313
    Helixi136 – 15116
    Helixi154 – 1596
    Helixi161 – 1677

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    EntryMethodResolution (Å)ChainPositionsPDBsum
    2F4WX-ray2.00A/B1-185[»]
    ProteinModelPortaliQ8N2K1.
    SMRiQ8N2K1. Positions 11-171.
    ModBaseiSearch...
    MobiDBiSearch...

    Miscellaneous databases

    EvolutionaryTraceiQ8N2K1.

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini1 – 226226CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini248 – 25912LumenalSequence AnalysisAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei227 – 24721Helical; Anchor for type IV membrane proteinSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Sequence similaritiesi

    Belongs to the ubiquitin-conjugating enzyme family.PROSITE-ProRule annotation

    Keywords - Domaini

    Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiCOG5078.
    HOGENOMiHOG000170330.
    HOVERGENiHBG058434.
    KOiK04554.
    OMAiTSDYTKR.
    OrthoDBiEOG780RNH.
    PhylomeDBiQ8N2K1.
    TreeFamiTF101123.

    Family and domain databases

    Gene3Di3.10.110.10. 1 hit.
    InterProiIPR000608. UBQ-conjugat_E2.
    IPR016135. UBQ-conjugating_enzyme/RWD.
    [Graphical view]
    PfamiPF00179. UQ_con. 1 hit.
    [Graphical view]
    SUPFAMiSSF54495. SSF54495. 1 hit.
    PROSITEiPS50127. UBIQUITIN_CONJUGAT_2. 1 hit.
    [Graphical view]

    Sequences (3)i

    Sequence statusi: Complete.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q8N2K1-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MSSTSSKRAP TTATQRLKQD YLRIKKDPVP YICAEPLPSN ILEWHYVVRG    50
    PEMTPYEGGY YHGKLIFPRE FPFKPPSIYM ITPNGRFKCN TRLCLSITDF 100
    HPDTWNPAWS VSTILTGLLS FMVEKGPTLG SIETSDFTKR QLAVQSLAFN 150
    LKDKVFCELF PEVVEEIKQK QKAQDELSSR PQTLPLPDVV PDGETHLVQN 200
    GIQLLNGHAP GAVPNLAGLQ QANRHHGLLG GALANLFVIV GFAAFAYTVK 250
    YVLRSIAQE 259
    Length:259
    Mass (Da):28,898
    Last modified:July 7, 2009 - v3
    Checksum:i7DB5280D2947CE7E
    GO
    Isoform 2 (identifier: Q8N2K1-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-44: MSSTSSKRAPTTATQRLKQDYLRIKKDPVPYICAEPLPSNILEW → MWPQDIAGR

    Note: No experimental confirmation available.

    Show »
    Length:224
    Mass (Da):24,937
    Checksum:iD5E649B09D7CC30E
    GO
    Isoform 3 (identifier: Q8N2K1-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         44-44: W → WFKRFSWLSLLSSWDYR

    Note: No experimental confirmation available.

    Show »
    Length:275
    Mass (Da):30,972
    Checksum:i602B2575ABC79E4E
    GO

    Sequence cautioni

    The sequence BM544827 differs from that shown. Reason:
    The sequence BM544827 differs from that shown. Reason: Frameshift at several positions.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti2 – 21S → N in BAC11355. (PubMed:14702039)Curated
    Sequence conflicti100 – 1001F → S in BAC11355. (PubMed:14702039)Curated
    Sequence conflicti214 – 23825PNLAG…ANLFV → QTSQGSSRPTGTTDSGWRPG ELVC in AAK52609. (PubMed:11278356)CuratedAdd
    BLAST

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 4444MSSTS…NILEW → MWPQDIAGR in isoform 2. 1 PublicationVSP_011572Add
    BLAST
    Alternative sequencei44 – 441W → WFKRFSWLSLLSSWDYR in isoform 3. 1 PublicationVSP_045219

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF296658 mRNA. Translation: AAK52609.1.
    AK056065 mRNA. Translation: BAB71086.1.
    AK075017 mRNA. Translation: BAC11355.1.
    AK291935 mRNA. Translation: BAF84624.1.
    AL162741 Genomic DNA. Translation: CAI23257.1.
    CH471183 Genomic DNA. Translation: EAW56256.1.
    CH471183 Genomic DNA. Translation: EAW56259.1.
    BC094777 mRNA. Translation: AAH94777.1.
    BC104890 mRNA. Translation: AAI04891.1.
    BC113430 mRNA. Translation: AAI13431.1.
    BC143657 mRNA. Translation: AAI43658.1.
    BM544827 mRNA. No translation available.
    CCDSiCCDS14.1. [Q8N2K1-1]
    CCDS15.1. [Q8N2K1-3]
    RefSeqiNP_477515.2. NM_058167.2. [Q8N2K1-1]
    NP_919296.1. NM_194315.1. [Q8N2K1-3]
    NP_919440.1. NM_194458.1.
    XP_005244775.1. XM_005244718.1. [Q8N2K1-1]
    XP_005244776.1. XM_005244719.2. [Q8N2K1-1]
    XP_006710396.1. XM_006710333.1. [Q8N2K1-1]
    UniGeneiHs.191987.

    Genome annotation databases

    EnsembliENST00000349431; ENSP00000305826; ENSG00000160087. [Q8N2K1-1]
    ENST00000360466; ENSP00000353653; ENSG00000160087. [Q8N2K1-1]
    ENST00000400930; ENSP00000383719; ENSG00000160087. [Q8N2K1-3]
    GeneIDi118424.
    KEGGihsa:118424.
    UCSCiuc001adm.4. human. [Q8N2K1-1]
    uc001ado.3. human.

    Polymorphism databases

    DMDMi251757431.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF296658 mRNA. Translation: AAK52609.1 .
    AK056065 mRNA. Translation: BAB71086.1 .
    AK075017 mRNA. Translation: BAC11355.1 .
    AK291935 mRNA. Translation: BAF84624.1 .
    AL162741 Genomic DNA. Translation: CAI23257.1 .
    CH471183 Genomic DNA. Translation: EAW56256.1 .
    CH471183 Genomic DNA. Translation: EAW56259.1 .
    BC094777 mRNA. Translation: AAH94777.1 .
    BC104890 mRNA. Translation: AAI04891.1 .
    BC113430 mRNA. Translation: AAI13431.1 .
    BC143657 mRNA. Translation: AAI43658.1 .
    BM544827 mRNA. No translation available.
    CCDSi CCDS14.1. [Q8N2K1-1 ]
    CCDS15.1. [Q8N2K1-3 ]
    RefSeqi NP_477515.2. NM_058167.2. [Q8N2K1-1 ]
    NP_919296.1. NM_194315.1. [Q8N2K1-3 ]
    NP_919440.1. NM_194458.1.
    XP_005244775.1. XM_005244718.1. [Q8N2K1-1 ]
    XP_005244776.1. XM_005244719.2. [Q8N2K1-1 ]
    XP_006710396.1. XM_006710333.1. [Q8N2K1-1 ]
    UniGenei Hs.191987.

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    Entry Method Resolution (Å) Chain Positions PDBsum
    2F4W X-ray 2.00 A/B 1-185 [» ]
    ProteinModelPortali Q8N2K1.
    SMRi Q8N2K1. Positions 11-171.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 125598. 11 interactions.
    IntActi Q8N2K1. 4 interactions.
    STRINGi 9606.ENSP00000383719.

    Polymorphism databases

    DMDMi 251757431.

    Proteomic databases

    MaxQBi Q8N2K1.
    PaxDbi Q8N2K1.
    PRIDEi Q8N2K1.

    Protocols and materials databases

    DNASUi 118424.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000349431 ; ENSP00000305826 ; ENSG00000160087 . [Q8N2K1-1 ]
    ENST00000360466 ; ENSP00000353653 ; ENSG00000160087 . [Q8N2K1-1 ]
    ENST00000400930 ; ENSP00000383719 ; ENSG00000160087 . [Q8N2K1-3 ]
    GeneIDi 118424.
    KEGGi hsa:118424.
    UCSCi uc001adm.4. human. [Q8N2K1-1 ]
    uc001ado.3. human.

    Organism-specific databases

    CTDi 118424.
    GeneCardsi GC01M001182.
    H-InvDB HIX0000017.
    HGNCi HGNC:19268. UBE2J2.
    HPAi HPA051399.
    neXtProti NX_Q8N2K1.
    PharmGKBi PA134882268.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG5078.
    HOGENOMi HOG000170330.
    HOVERGENi HBG058434.
    KOi K04554.
    OMAi TSDYTKR.
    OrthoDBi EOG780RNH.
    PhylomeDBi Q8N2K1.
    TreeFami TF101123.

    Enzyme and pathway databases

    UniPathwayi UPA00143 .
    Reactomei REACT_75842. Antigen processing: Ubiquitination & Proteasome degradation.
    SignaLinki Q8N2K1.

    Miscellaneous databases

    ChiTaRSi UBE2J2. human.
    EvolutionaryTracei Q8N2K1.
    GenomeRNAii 118424.
    NextBioi 80253.
    PROi Q8N2K1.

    Gene expression databases

    ArrayExpressi Q8N2K1.
    Bgeei Q8N2K1.
    CleanExi HS_UBE2J2.
    Genevestigatori Q8N2K1.

    Family and domain databases

    Gene3Di 3.10.110.10. 1 hit.
    InterProi IPR000608. UBQ-conjugat_E2.
    IPR016135. UBQ-conjugating_enzyme/RWD.
    [Graphical view ]
    Pfami PF00179. UQ_con. 1 hit.
    [Graphical view ]
    SUPFAMi SSF54495. SSF54495. 1 hit.
    PROSITEi PS50127. UBIQUITIN_CONJUGAT_2. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Endoplasmic reticulum (ER)-associated degradation of T cell receptor subunits. Involvement of ER-associated ubiquitin-conjugating enzymes (E2s)."
      Tiwari S., Weissman A.M.
      J. Biol. Chem. 276:16193-16200(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
      Tissue: Ovary.
    3. "The DNA sequence and biological annotation of human chromosome 1."
      Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K.
      , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
      Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-205 (ISOFORM 3).
      Tissue: Brain, Hippocampus and Placenta.
    6. "Structure of the endoplasmic reticulum (ER)-associated human ubiquitin-conjugating enzyme E2 J2."
      Structural genomics consortium (SGC)
      Submitted (NOV-2005) to the PDB data bank
      Cited for: X-RAY CRYSTALLOGRAPHY (2.0 ANGSTROMS) OF 1-185.

    Entry informationi

    Entry nameiUB2J2_HUMAN
    AccessioniPrimary (citable) accession number: Q8N2K1
    Secondary accession number(s): A8MYC7
    , Q504T9, Q96N26, Q96T84
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: September 13, 2004
    Last sequence update: July 7, 2009
    Last modified: October 1, 2014
    This is version 111 of the entry and version 3 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    3D-structure, Complete proteome, Reference proteome

    Documents

    1. Human chromosome 1
      Human chromosome 1: entries, gene names and cross-references to MIM
    2. PATHWAY comments
      Index of metabolic and biosynthesis pathways
    3. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    4. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3