Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q8N2K1 (UB2J2_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 107. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (4) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Ubiquitin-conjugating enzyme E2 J2

EC=6.3.2.19
Alternative name(s):
Non-canonical ubiquitin-conjugating enzyme 2
Short name=NCUBE-2
Gene names
Name:UBE2J2
Synonyms:NCUBE2
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length259 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Catalyzes the covalent attachment of ubiquitin to other proteins. Seems to function in the selective degradation of misfolded membrane proteins from the endoplasmic reticulum (ERAD) By similarity.

Catalytic activity

ATP + ubiquitin + protein lysine = AMP + diphosphate + protein N-ubiquityllysine.

Pathway

Protein modification; protein ubiquitination.

Subcellular location

Endoplasmic reticulum membrane; Single-pass type IV membrane protein By similarity.

Sequence similarities

Belongs to the ubiquitin-conjugating enzyme family.

Sequence caution

The sequence BM544827 differs from that shown. Reason: Frameshift at several positions.

The sequence BM544827 differs from that shown. Reason:

Ontologies

Alternative products

This entry describes 3 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q8N2K1-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q8N2K1-2)

The sequence of this isoform differs from the canonical sequence as follows:
     1-44: MSSTSSKRAPTTATQRLKQDYLRIKKDPVPYICAEPLPSNILEW → MWPQDIAGR
Note: No experimental confirmation available.
Isoform 3 (identifier: Q8N2K1-3)

The sequence of this isoform differs from the canonical sequence as follows:
     44-44: W → WFKRFSWLSLLSSWDYR
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 259259Ubiquitin-conjugating enzyme E2 J2
PRO_0000082596

Regions

Topological domain1 – 226226Cytoplasmic Potential
Transmembrane227 – 24721Helical; Anchor for type IV membrane protein; Potential
Topological domain248 – 25912Lumenal Potential

Sites

Active site941Glycyl thioester intermediate By similarity

Natural variations

Alternative sequence1 – 4444MSSTS…NILEW → MWPQDIAGR in isoform 2.
VSP_011572
Alternative sequence441W → WFKRFSWLSLLSSWDYR in isoform 3.
VSP_045219

Experimental info

Sequence conflict21S → N in BAC11355. Ref.2
Sequence conflict1001F → S in BAC11355. Ref.2
Sequence conflict214 – 23825PNLAG…ANLFV → QTSQGSSRPTGTTDSGWRPG ELVC in AAK52609. Ref.1

Secondary structure

......................... 259
Helix Strand Turn

Details...

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified July 7, 2009. Version 3.
Checksum: 7DB5280D2947CE7E

FASTA25928,898
        10         20         30         40         50         60 
MSSTSSKRAP TTATQRLKQD YLRIKKDPVP YICAEPLPSN ILEWHYVVRG PEMTPYEGGY 

        70         80         90        100        110        120 
YHGKLIFPRE FPFKPPSIYM ITPNGRFKCN TRLCLSITDF HPDTWNPAWS VSTILTGLLS 

       130        140        150        160        170        180 
FMVEKGPTLG SIETSDFTKR QLAVQSLAFN LKDKVFCELF PEVVEEIKQK QKAQDELSSR 

       190        200        210        220        230        240 
PQTLPLPDVV PDGETHLVQN GIQLLNGHAP GAVPNLAGLQ QANRHHGLLG GALANLFVIV 

       250 
GFAAFAYTVK YVLRSIAQE 

« Hide

Isoform 2 [UniParc].

Checksum: D5E649B09D7CC30E
Show »

FASTA22424,937
Isoform 3 [UniParc].

Checksum: 602B2575ABC79E4E
Show »

FASTA27530,972

References

« Hide 'large scale' references
[1]"Endoplasmic reticulum (ER)-associated degradation of T cell receptor subunits. Involvement of ER-associated ubiquitin-conjugating enzymes (E2s)."
Tiwari S., Weissman A.M.
J. Biol. Chem. 276:16193-16200(2001) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
[2]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
Tissue: Ovary.
[3]"The DNA sequence and biological annotation of human chromosome 1."
Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K. expand/collapse author list , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[4]Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[5]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-205 (ISOFORM 3).
Tissue: Brain, Hippocampus and Placenta.
[6]"Structure of the endoplasmic reticulum (ER)-associated human ubiquitin-conjugating enzyme E2 J2."
Structural genomics consortium (SGC)
Submitted (NOV-2005) to the PDB data bank
Cited for: X-RAY CRYSTALLOGRAPHY (2.0 ANGSTROMS) OF 1-185.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AF296658 mRNA. Translation: AAK52609.1.
AK056065 mRNA. Translation: BAB71086.1.
AK075017 mRNA. Translation: BAC11355.1.
AK291935 mRNA. Translation: BAF84624.1.
AL162741 Genomic DNA. Translation: CAI23257.1.
CH471183 Genomic DNA. Translation: EAW56256.1.
CH471183 Genomic DNA. Translation: EAW56259.1.
BC094777 mRNA. Translation: AAH94777.1.
BC104890 mRNA. Translation: AAI04891.1.
BC113430 mRNA. Translation: AAI13431.1.
BC143657 mRNA. Translation: AAI43658.1.
BM544827 mRNA. No translation available.
RefSeqNP_477515.2. NM_058167.2.
NP_919296.1. NM_194315.1.
NP_919440.1. NM_194458.1.
XP_005244775.1. XM_005244718.1.
XP_005244776.1. XM_005244719.2.
UniGeneHs.191987.

3D structure databases

PDBe
RCSB PDB
PDBj
EntryMethodResolution (Å)ChainPositionsPDBsum
2F4WX-ray2.00A/B1-185[»]
ProteinModelPortalQ8N2K1.
SMRQ8N2K1. Positions 11-171.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid125598. 11 interactions.
IntActQ8N2K1. 4 interactions.
STRING9606.ENSP00000383719.

Polymorphism databases

DMDM251757431.

Proteomic databases

PaxDbQ8N2K1.
PRIDEQ8N2K1.

Protocols and materials databases

DNASU118424.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000339385; ENSP00000340197; ENSG00000160087. [Q8N2K1-2]
ENST00000349431; ENSP00000305826; ENSG00000160087. [Q8N2K1-1]
ENST00000360466; ENSP00000353653; ENSG00000160087. [Q8N2K1-1]
ENST00000400930; ENSP00000383719; ENSG00000160087. [Q8N2K1-3]
GeneID118424.
KEGGhsa:118424.
UCSCuc001adm.4. human. [Q8N2K1-1]
uc001ado.3. human.

Organism-specific databases

CTD118424.
GeneCardsGC01M001182.
H-InvDBHIX0000017.
HGNCHGNC:19268. UBE2J2.
HPAHPA051399.
neXtProtNX_Q8N2K1.
PharmGKBPA134882268.
GenAtlasSearch...

Phylogenomic databases

eggNOGCOG5078.
HOGENOMHOG000170330.
HOVERGENHBG058434.
KOK04554.
OMATSDYTKR.
OrthoDBEOG780RNH.
PhylomeDBQ8N2K1.
TreeFamTF101123.

Enzyme and pathway databases

ReactomeREACT_6900. Immune System.
SignaLinkQ8N2K1.
UniPathwayUPA00143.

Gene expression databases

ArrayExpressQ8N2K1.
BgeeQ8N2K1.
CleanExHS_UBE2J2.
GenevestigatorQ8N2K1.

Family and domain databases

Gene3D3.10.110.10. 1 hit.
InterProIPR000608. UBQ-conjugat_E2.
IPR016135. UBQ-conjugating_enzyme/RWD.
[Graphical view]
PfamPF00179. UQ_con. 1 hit.
[Graphical view]
SUPFAMSSF54495. SSF54495. 1 hit.
PROSITEPS50127. UBIQUITIN_CONJUGAT_2. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

ChiTaRSUBE2J2. human.
EvolutionaryTraceQ8N2K1.
GenomeRNAi118424.
NextBio80253.
PROQ8N2K1.

Entry information

Entry nameUB2J2_HUMAN
AccessionPrimary (citable) accession number: Q8N2K1
Secondary accession number(s): A8MYC7 expand/collapse secondary AC list , Q504T9, Q96N26, Q96T84
Entry history
Integrated into UniProtKB/Swiss-Prot: September 13, 2004
Last sequence update: July 7, 2009
Last modified: April 16, 2014
This is version 107 of the entry and version 3 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

PDB cross-references

Index of Protein Data Bank (PDB) cross-references

PATHWAY comments

Index of metabolic and biosynthesis pathways

Human chromosome 1

Human chromosome 1: entries, gene names and cross-references to MIM