Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Ubiquitin-conjugating enzyme E2 J2

Gene

UBE2J2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Catalyzes the covalent attachment of ubiquitin to other proteins. Seems to function in the selective degradation of misfolded membrane proteins from the endoplasmic reticulum (ERAD) (By similarity).PROSITE-ProRule annotation

Catalytic activityi

ATP + ubiquitin + protein lysine = AMP + diphosphate + protein N-ubiquityllysine.PROSITE-ProRule annotation

Pathwayi

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Active sitei94 – 941Glycyl thioester intermediatePROSITE-ProRule annotation

GO - Molecular functioni

  1. ATP binding Source: UniProtKB-KW
  2. ligase activity Source: UniProtKB-KW
  3. ubiquitin conjugating enzyme activity Source: MGI
  4. ubiquitin-like protein transferase activity Source: GO_Central
  5. ubiquitin protein ligase activity Source: GO_Central
  6. ubiquitin protein ligase binding Source: GO_Central

GO - Biological processi

  1. ER-associated ubiquitin-dependent protein catabolic process Source: GO_Central
  2. protein polyubiquitination Source: GO_Central
  3. response to unfolded protein Source: UniProtKB-KW
Complete GO annotation...

Keywords - Molecular functioni

Ligase

Keywords - Biological processi

Ubl conjugation pathway, Unfolded protein response

Keywords - Ligandi

ATP-binding, Nucleotide-binding

Enzyme and pathway databases

ReactomeiREACT_75842. Antigen processing: Ubiquitination & Proteasome degradation.
SignaLinkiQ8N2K1.
UniPathwayiUPA00143.

Names & Taxonomyi

Protein namesi
Recommended name:
Ubiquitin-conjugating enzyme E2 J2 (EC:6.3.2.19)
Alternative name(s):
Non-canonical ubiquitin-conjugating enzyme 2
Short name:
NCUBE-2
Gene namesi
Name:UBE2J2
Synonyms:NCUBE2
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640 Componenti: Chromosome 1

Organism-specific databases

HGNCiHGNC:19268. UBE2J2.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini1 – 226226CytoplasmicSequence AnalysisAdd
BLAST
Transmembranei227 – 24721Helical; Anchor for type IV membrane proteinSequence AnalysisAdd
BLAST
Topological domaini248 – 25912LumenalSequence AnalysisAdd
BLAST

GO - Cellular componenti

  1. endoplasmic reticulum Source: GO_Central
  2. endoplasmic reticulum membrane Source: UniProtKB-SubCell
  3. integral component of membrane Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Endoplasmic reticulum, Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134882268.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 259259Ubiquitin-conjugating enzyme E2 J2PRO_0000082596Add
BLAST

Proteomic databases

MaxQBiQ8N2K1.
PaxDbiQ8N2K1.
PRIDEiQ8N2K1.

Expressioni

Gene expression databases

BgeeiQ8N2K1.
CleanExiHS_UBE2J2.
ExpressionAtlasiQ8N2K1. baseline and differential.
GenevestigatoriQ8N2K1.

Organism-specific databases

HPAiHPA051399.

Interactioni

Protein-protein interaction databases

BioGridi125598. 12 interactions.
IntActiQ8N2K1. 4 interactions.
STRINGi9606.ENSP00000383719.

Structurei

Secondary structure

1
259
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Helixi13 – 2614Combined sources
Beta strandi32 – 376Combined sources
Beta strandi40 – 4910Combined sources
Turni55 – 584Combined sources
Beta strandi60 – 667Combined sources
Turni69 – 724Combined sources
Beta strandi77 – 804Combined sources
Beta strandi85 – 873Combined sources
Helixi111 – 12313Combined sources
Helixi136 – 15116Combined sources
Helixi154 – 1596Combined sources
Helixi161 – 1677Combined sources

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
2F4WX-ray2.00A/B1-185[»]
ProteinModelPortaliQ8N2K1.
SMRiQ8N2K1. Positions 11-171.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ8N2K1.

Family & Domainsi

Sequence similaritiesi

Belongs to the ubiquitin-conjugating enzyme family.PROSITE-ProRule annotation

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiCOG5078.
GeneTreeiENSGT00530000063379.
HOGENOMiHOG000170330.
HOVERGENiHBG058434.
InParanoidiQ8N2K1.
KOiK04554.
OMAiRFKVNTR.
OrthoDBiEOG780RNH.
PhylomeDBiQ8N2K1.
TreeFamiTF101123.

Family and domain databases

Gene3Di3.10.110.10. 1 hit.
InterProiIPR000608. UBQ-conjugat_E2.
IPR016135. UBQ-conjugating_enzyme/RWD.
[Graphical view]
PfamiPF00179. UQ_con. 1 hit.
[Graphical view]
SUPFAMiSSF54495. SSF54495. 1 hit.
PROSITEiPS50127. UBIQUITIN_CONJUGAT_2. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8N2K1-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSSTSSKRAP TTATQRLKQD YLRIKKDPVP YICAEPLPSN ILEWHYVVRG
60 70 80 90 100
PEMTPYEGGY YHGKLIFPRE FPFKPPSIYM ITPNGRFKCN TRLCLSITDF
110 120 130 140 150
HPDTWNPAWS VSTILTGLLS FMVEKGPTLG SIETSDFTKR QLAVQSLAFN
160 170 180 190 200
LKDKVFCELF PEVVEEIKQK QKAQDELSSR PQTLPLPDVV PDGETHLVQN
210 220 230 240 250
GIQLLNGHAP GAVPNLAGLQ QANRHHGLLG GALANLFVIV GFAAFAYTVK

YVLRSIAQE
Length:259
Mass (Da):28,898
Last modified:July 7, 2009 - v3
Checksum:i7DB5280D2947CE7E
GO
Isoform 2 (identifier: Q8N2K1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-44: MSSTSSKRAPTTATQRLKQDYLRIKKDPVPYICAEPLPSNILEW → MWPQDIAGR

Note: No experimental confirmation available.

Show »
Length:224
Mass (Da):24,937
Checksum:iD5E649B09D7CC30E
GO
Isoform 3 (identifier: Q8N2K1-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     44-44: W → WFKRFSWLSLLSSWDYR

Note: No experimental confirmation available.

Show »
Length:275
Mass (Da):30,972
Checksum:i602B2575ABC79E4E
GO

Sequence cautioni

The sequence BM544827 differs from that shown.Curated
The sequence BM544827 differs from that shown. Reason: Frameshift at several positions. Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti2 – 21S → N in BAC11355 (PubMed:14702039).Curated
Sequence conflicti100 – 1001F → S in BAC11355 (PubMed:14702039).Curated
Sequence conflicti214 – 23825PNLAG…ANLFV → QTSQGSSRPTGTTDSGWRPG ELVC in AAK52609 (PubMed:11278356).CuratedAdd
BLAST

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 4444MSSTS…NILEW → MWPQDIAGR in isoform 2. 1 PublicationVSP_011572Add
BLAST
Alternative sequencei44 – 441W → WFKRFSWLSLLSSWDYR in isoform 3. 1 PublicationVSP_045219

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF296658 mRNA. Translation: AAK52609.1.
AK056065 mRNA. Translation: BAB71086.1.
AK075017 mRNA. Translation: BAC11355.1.
AK291935 mRNA. Translation: BAF84624.1.
AL162741 Genomic DNA. Translation: CAI23257.1.
CH471183 Genomic DNA. Translation: EAW56256.1.
CH471183 Genomic DNA. Translation: EAW56259.1.
BC094777 mRNA. Translation: AAH94777.1.
BC104890 mRNA. Translation: AAI04891.1.
BC113430 mRNA. Translation: AAI13431.1.
BC143657 mRNA. Translation: AAI43658.1.
BM544827 mRNA. No translation available.
CCDSiCCDS14.1. [Q8N2K1-1]
CCDS15.1. [Q8N2K1-3]
RefSeqiNP_477515.2. NM_058167.2. [Q8N2K1-1]
NP_919296.1. NM_194315.1. [Q8N2K1-3]
NP_919440.1. NM_194458.1.
XP_005244775.1. XM_005244718.1. [Q8N2K1-1]
XP_005244776.1. XM_005244719.2. [Q8N2K1-1]
XP_006710396.1. XM_006710333.1. [Q8N2K1-1]
UniGeneiHs.191987.

Genome annotation databases

EnsembliENST00000349431; ENSP00000305826; ENSG00000160087. [Q8N2K1-1]
ENST00000360466; ENSP00000353653; ENSG00000160087. [Q8N2K1-1]
ENST00000400930; ENSP00000383719; ENSG00000160087. [Q8N2K1-3]
GeneIDi118424.
KEGGihsa:118424.
UCSCiuc001adm.4. human. [Q8N2K1-1]
uc001ado.3. human.

Polymorphism databases

DMDMi251757431.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF296658 mRNA. Translation: AAK52609.1.
AK056065 mRNA. Translation: BAB71086.1.
AK075017 mRNA. Translation: BAC11355.1.
AK291935 mRNA. Translation: BAF84624.1.
AL162741 Genomic DNA. Translation: CAI23257.1.
CH471183 Genomic DNA. Translation: EAW56256.1.
CH471183 Genomic DNA. Translation: EAW56259.1.
BC094777 mRNA. Translation: AAH94777.1.
BC104890 mRNA. Translation: AAI04891.1.
BC113430 mRNA. Translation: AAI13431.1.
BC143657 mRNA. Translation: AAI43658.1.
BM544827 mRNA. No translation available.
CCDSiCCDS14.1. [Q8N2K1-1]
CCDS15.1. [Q8N2K1-3]
RefSeqiNP_477515.2. NM_058167.2. [Q8N2K1-1]
NP_919296.1. NM_194315.1. [Q8N2K1-3]
NP_919440.1. NM_194458.1.
XP_005244775.1. XM_005244718.1. [Q8N2K1-1]
XP_005244776.1. XM_005244719.2. [Q8N2K1-1]
XP_006710396.1. XM_006710333.1. [Q8N2K1-1]
UniGeneiHs.191987.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
2F4WX-ray2.00A/B1-185[»]
ProteinModelPortaliQ8N2K1.
SMRiQ8N2K1. Positions 11-171.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi125598. 12 interactions.
IntActiQ8N2K1. 4 interactions.
STRINGi9606.ENSP00000383719.

Polymorphism databases

DMDMi251757431.

Proteomic databases

MaxQBiQ8N2K1.
PaxDbiQ8N2K1.
PRIDEiQ8N2K1.

Protocols and materials databases

DNASUi118424.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000349431; ENSP00000305826; ENSG00000160087. [Q8N2K1-1]
ENST00000360466; ENSP00000353653; ENSG00000160087. [Q8N2K1-1]
ENST00000400930; ENSP00000383719; ENSG00000160087. [Q8N2K1-3]
GeneIDi118424.
KEGGihsa:118424.
UCSCiuc001adm.4. human. [Q8N2K1-1]
uc001ado.3. human.

Organism-specific databases

CTDi118424.
GeneCardsiGC01M001189.
H-InvDBHIX0000017.
HGNCiHGNC:19268. UBE2J2.
HPAiHPA051399.
neXtProtiNX_Q8N2K1.
PharmGKBiPA134882268.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiCOG5078.
GeneTreeiENSGT00530000063379.
HOGENOMiHOG000170330.
HOVERGENiHBG058434.
InParanoidiQ8N2K1.
KOiK04554.
OMAiRFKVNTR.
OrthoDBiEOG780RNH.
PhylomeDBiQ8N2K1.
TreeFamiTF101123.

Enzyme and pathway databases

UniPathwayiUPA00143.
ReactomeiREACT_75842. Antigen processing: Ubiquitination & Proteasome degradation.
SignaLinkiQ8N2K1.

Miscellaneous databases

ChiTaRSiUBE2J2. human.
EvolutionaryTraceiQ8N2K1.
GenomeRNAii118424.
NextBioi80253.
PROiQ8N2K1.

Gene expression databases

BgeeiQ8N2K1.
CleanExiHS_UBE2J2.
ExpressionAtlasiQ8N2K1. baseline and differential.
GenevestigatoriQ8N2K1.

Family and domain databases

Gene3Di3.10.110.10. 1 hit.
InterProiIPR000608. UBQ-conjugat_E2.
IPR016135. UBQ-conjugating_enzyme/RWD.
[Graphical view]
PfamiPF00179. UQ_con. 1 hit.
[Graphical view]
SUPFAMiSSF54495. SSF54495. 1 hit.
PROSITEiPS50127. UBIQUITIN_CONJUGAT_2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Endoplasmic reticulum (ER)-associated degradation of T cell receptor subunits. Involvement of ER-associated ubiquitin-conjugating enzymes (E2s)."
    Tiwari S., Weissman A.M.
    J. Biol. Chem. 276:16193-16200(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
  2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
    Tissue: Ovary.
  3. "The DNA sequence and biological annotation of human chromosome 1."
    Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K.
    , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
    Nature 441:315-321(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-205 (ISOFORM 3).
    Tissue: Brain, Hippocampus and Placenta.
  6. "Structure of the endoplasmic reticulum (ER)-associated human ubiquitin-conjugating enzyme E2 J2."
    Structural genomics consortium (SGC)
    Submitted (OCT-2005) to the PDB data bank
    Cited for: X-RAY CRYSTALLOGRAPHY (2.0 ANGSTROMS) OF 1-185.

Entry informationi

Entry nameiUB2J2_HUMAN
AccessioniPrimary (citable) accession number: Q8N2K1
Secondary accession number(s): A8MYC7
, Q504T9, Q96N26, Q96T84
Entry historyi
Integrated into UniProtKB/Swiss-Prot: September 13, 2004
Last sequence update: July 7, 2009
Last modified: April 1, 2015
This is version 117 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.