Q8N2K1 (UB2J2_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 99.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Ubiquitin-conjugating enzyme E2 J2 EC=6.3.2.19 Alternative name(s): Non-canonical ubiquitin-conjugating enzyme 2 Short name=NCUBE-2 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 259 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Catalyzes the covalent attachment of ubiquitin to other proteins. Seems to function in the selective degradation of misfolded membrane proteins from the endoplasmic reticulum (ERAD) By similarity. |
| Catalytic activity | ATP + ubiquitin + protein lysine = AMP + diphosphate + protein N-ubiquityllysine. |
| Pathway | |
| Subcellular location | Endoplasmic reticulum membrane; Single-pass type IV membrane protein By similarity. |
| Sequence similarities | Belongs to the ubiquitin-conjugating enzyme family. |
| Sequence caution | The sequence BM544827 differs from that shown. Reason: Frameshift at several positions. The sequence BM544827 differs from that shown. Reason: |
Ontologies
| Keywords | |
|---|---|
| Biological process | Ubl conjugation pathway Unfolded protein response |
| Cellular component | Endoplasmic reticulum Membrane |
| Coding sequence diversity | Alternative splicing |
| Domain | Transmembrane Transmembrane helix |
| Ligand | ATP-binding Nucleotide-binding |
| Molecular function | Ligase |
| Technical term | 3D-structure Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | response to unfolded protein Inferred from electronic annotation. Source: UniProtKB-KW |
| Cellular_component | endoplasmic reticulum membrane Inferred from electronic annotation. Source: UniProtKB-SubCell integral to membraneInferred from electronic annotation. Source: UniProtKB-KW |
| Molecular_function | ATP binding Inferred from electronic annotation. Source: UniProtKB-KW ubiquitin-protein ligase activityInferred from electronic annotation. Source: EC |
| Complete GO annotation... | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q8N2K1-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q8N2K1-2) The sequence of this isoform differs from the canonical sequence as follows: 1-44: MSSTSSKRAPTTATQRLKQDYLRIKKDPVPYICAEPLPSNILEW → MWPQDIAGR | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: Q8N2K1-3) The sequence of this isoform differs from the canonical sequence as follows: 44-44: W → WFKRFSWLSLLSSWDYR | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 259 | 259 | Ubiquitin-conjugating enzyme E2 J2 | PRO_0000082596 | |||||||||||||||||||||||||||||
Regions | |||||||||||||||||||||||||||||||||
| Topological domain | 1 – 226 | 226 | Cytoplasmic Potential | ||||||||||||||||||||||||||||||
| Transmembrane | 227 – 247 | 21 | Helical; Anchor for type IV membrane protein; Potential | ||||||||||||||||||||||||||||||
| Topological domain | 248 – 259 | 12 | Lumenal Potential | ||||||||||||||||||||||||||||||
Sites | |||||||||||||||||||||||||||||||||
| Active site | 94 | 1 | Glycyl thioester intermediate By similarity | ||||||||||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 44 | 44 | MSSTS…NILEW → MWPQDIAGR in isoform 2. | VSP_011572 | |||||||||||||||||||||||||||||
| Alternative sequence | 44 | 1 | W → WFKRFSWLSLLSSWDYR in isoform 3. | VSP_045219 | |||||||||||||||||||||||||||||
Experimental info | |||||||||||||||||||||||||||||||||
| Sequence conflict | 2 | 1 | S → N in BAC11355. Ref.2 | ||||||||||||||||||||||||||||||
| Sequence conflict | 100 | 1 | F → S in BAC11355. Ref.2 | ||||||||||||||||||||||||||||||
| Sequence conflict | 214 – 238 | 25 | PNLAG…ANLFV → QTSQGSSRPTGTTDSGWRPG ELVC in AAK52609. Ref.1 | ||||||||||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||||||||||
| Helix | 13 – 26 | 14 | |||||||||||||||||||||||||||||||
| Beta strand | 32 – 37 | 6 | |||||||||||||||||||||||||||||||
| Beta strand | 40 – 49 | 10 | |||||||||||||||||||||||||||||||
| Turn | 55 – 58 | 4 | |||||||||||||||||||||||||||||||
| Beta strand | 60 – 66 | 7 | |||||||||||||||||||||||||||||||
| Turn | 69 – 72 | 4 | |||||||||||||||||||||||||||||||
| Beta strand | 77 – 80 | 4 | |||||||||||||||||||||||||||||||
| Beta strand | 85 – 87 | 3 | |||||||||||||||||||||||||||||||
| Helix | 111 – 123 | 13 | |||||||||||||||||||||||||||||||
| Helix | 136 – 151 | 16 | |||||||||||||||||||||||||||||||
| Helix | 154 – 159 | 6 | |||||||||||||||||||||||||||||||
| Helix | 161 – 167 | 7 | |||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Endoplasmic reticulum (ER)-associated degradation of T cell receptor subunits. Involvement of ER-associated ubiquitin-conjugating enzymes (E2s)." Tiwari S., Weissman A.M. J. Biol. Chem. 276:16193-16200(2001) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [2] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2). Tissue: Ovary. |
| [3] | "The DNA sequence and biological annotation of human chromosome 1." Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K. Bentley D.R.Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-205 (ISOFORM 3). Tissue: Brain, Hippocampus and Placenta. |
| [6] | "Structure of the endoplasmic reticulum (ER)-associated human ubiquitin-conjugating enzyme E2 J2." Structural genomics consortium (SGC) Submitted (NOV-2005) to the PDB data bank Cited for: X-RAY CRYSTALLOGRAPHY (2.0 ANGSTROMS) OF 1-185. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AF296658 mRNA. Translation: AAK52609.1. AK056065 mRNA. Translation: BAB71086.1. AK075017 mRNA. Translation: BAC11355.1. AK291935 mRNA. Translation: BAF84624.1. AL162741 Genomic DNA. Translation: CAI23257.1. CH471183 Genomic DNA. Translation: EAW56256.1. CH471183 Genomic DNA. Translation: EAW56259.1. BC094777 mRNA. Translation: AAH94777.1. BC104890 mRNA. Translation: AAI04891.1. BC113430 mRNA. Translation: AAI13431.1. BC143657 mRNA. Translation: AAI43658.1. BM544827 mRNA. No translation available. | ||||||||||||
| IPI | IPI00455911. IPI00514050. IPI00873186. | ||||||||||||
| RefSeq | NP_477515.2. NM_058167.2. NP_919296.1. NM_194315.1. NP_919440.1. NM_194458.1. | ||||||||||||
| UniGene | Hs.191987. | ||||||||||||
3D structure databases | |||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||
| ProteinModelPortal | Q8N2K1. | ||||||||||||
| ModBase | Search... | ||||||||||||
Protein-protein interaction databases | |||||||||||||
| IntAct | Q8N2K1. 4 interactions. | ||||||||||||
| STRING | 9606.ENSP00000383719. | ||||||||||||
Polymorphism databases | |||||||||||||
| DMDM | 251757431. | ||||||||||||
Proteomic databases | |||||||||||||
| PaxDb | Q8N2K1. | ||||||||||||
| PRIDE | Q8N2K1. | ||||||||||||
Protocols and materials databases | |||||||||||||
| DNASU | 118424. | ||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||
Genome annotation databases | |||||||||||||
| Ensembl | ENST00000339385; ENSP00000340197; ENSG00000160087. ENST00000349431; ENSP00000305826; ENSG00000160087. ENST00000360466; ENSP00000353653; ENSG00000160087. ENST00000400930; ENSP00000383719; ENSG00000160087. | ||||||||||||
| GeneID | 118424. | ||||||||||||
| KEGG | hsa:118424. | ||||||||||||
| UCSC | uc001adm.3. human. uc001adp.3. human. | ||||||||||||
Organism-specific databases | |||||||||||||
| CTD | 118424. | ||||||||||||
| GeneCards | GC01M001182. | ||||||||||||
| H-InvDB | HIX0000017. | ||||||||||||
| HGNC | HGNC:19268. UBE2J2. | ||||||||||||
| HPA | HPA051399. | ||||||||||||
| neXtProt | NX_Q8N2K1. | ||||||||||||
| PharmGKB | PA134882268. | ||||||||||||
| GenAtlas | Search... | ||||||||||||
Phylogenomic databases | |||||||||||||
| eggNOG | COG5078. | ||||||||||||
| HOGENOM | HOG000170330. | ||||||||||||
| HOVERGEN | HBG058434. | ||||||||||||
| KO | K04554. | ||||||||||||
| OMA | TSDYTKR. | ||||||||||||
Enzyme and pathway databases | |||||||||||||
| Reactome | REACT_6900. Immune System. | ||||||||||||
| UniPathway | UPA00143. | ||||||||||||
Gene expression databases | |||||||||||||
| ArrayExpress | Q8N2K1. | ||||||||||||
| Bgee | Q8N2K1. | ||||||||||||
| CleanEx | HS_UBE2J2. | ||||||||||||
| Genevestigator | Q8N2K1. | ||||||||||||
| GermOnline | ENSG00000160087. Homo sapiens. | ||||||||||||
Family and domain databases | |||||||||||||
| Gene3D | 3.10.110.10. 1 hit. | ||||||||||||
| InterPro | IPR000608. UBQ-conjugat_E2. IPR016135. UBQ-conjugating_enzyme/RWD. [Graphical view] | ||||||||||||
| Pfam | PF00179. UQ_con. 1 hit. [Graphical view] | ||||||||||||
| SUPFAM | SSF54495. UBQ-conjugat/RWD-like. 1 hit. | ||||||||||||
| PROSITE | PS00183. UBIQUITIN_CONJUGAT_1. False negative. PS50127. UBIQUITIN_CONJUGAT_2. 1 hit. [Graphical view] | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other | |||||||||||||
| ChiTaRS | UBE2J2. human. | ||||||||||||
| EvolutionaryTrace | Q8N2K1. | ||||||||||||
| GenomeRNAi | 118424. | ||||||||||||
| NextBio | 80253. | ||||||||||||
Entry information
| Entry name | UB2J2_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q8N2K1 Secondary accession number(s): A8MYC7 Q96T84 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 1 Human chromosome 1: entries, gene names and cross-references to MIM |
| PATHWAY comments Index of metabolic and biosynthesis pathways |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
