Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Ubiquitin-conjugating enzyme E2 J2

Gene

UBE2J2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Catalyzes the covalent attachment of ubiquitin to other proteins. Seems to function in the selective degradation of misfolded membrane proteins from the endoplasmic reticulum (ERAD).PROSITE-ProRule annotation

Catalytic activityi

S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [E2 ubiquitin-conjugating enzyme]-L-cysteine = [E1 ubiquitin-activating enzyme]-L-cysteine + S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine.PROSITE-ProRule annotation

Pathwayi: protein ubiquitination

This protein is involved in the pathway protein ubiquitination, which is part of Protein modification.PROSITE-ProRule annotation
View all proteins of this organism that are known to be involved in the pathway protein ubiquitination and in Protein modification.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Active sitei94Glycyl thioester intermediatePROSITE-ProRule annotation1

GO - Molecular functioni

  • ATP binding Source: UniProtKB-KW
  • ubiquitin conjugating enzyme activity Source: MGI
  • ubiquitin protein ligase activity Source: GO_Central
  • ubiquitin protein ligase binding Source: ParkinsonsUK-UCL

GO - Biological processi

  • ER-associated ubiquitin-dependent protein catabolic process Source: ParkinsonsUK-UCL
  • positive regulation of protein targeting to mitochondrion Source: ParkinsonsUK-UCL
  • protein polyubiquitination Source: GO_Central
  • response to unfolded protein Source: UniProtKB-KW
Complete GO annotation...

Keywords - Molecular functioni

Transferase

Keywords - Biological processi

Ubl conjugation pathway, Unfolded protein response

Keywords - Ligandi

ATP-binding, Nucleotide-binding

Enzyme and pathway databases

BioCyciZFISH:HS08445-MONOMER.
ReactomeiR-HSA-983168. Antigen processing: Ubiquitination & Proteasome degradation.
SignaLinkiQ8N2K1.
UniPathwayiUPA00143.

Names & Taxonomyi

Protein namesi
Recommended name:
Ubiquitin-conjugating enzyme E2 J2 (EC:2.3.2.23)
Alternative name(s):
E2 ubiquitin-conjugating enzyme J2
Non-canonical ubiquitin-conjugating enzyme 2
Short name:
NCUBE-2
Gene namesi
Name:UBE2J2
Synonyms:NCUBE2
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

HGNCiHGNC:19268. UBE2J2.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 226CytoplasmicSequence analysisAdd BLAST226
Transmembranei227 – 247Helical; Anchor for type IV membrane proteinSequence analysisAdd BLAST21
Topological domaini248 – 259LumenalSequence analysisAdd BLAST12

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Endoplasmic reticulum, Membrane

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000160087.
PharmGKBiPA134882268.

Polymorphism and mutation databases

BioMutaiUBE2J2.
DMDMi251757431.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000825961 – 259Ubiquitin-conjugating enzyme E2 J2Add BLAST259

Proteomic databases

EPDiQ8N2K1.
MaxQBiQ8N2K1.
PeptideAtlasiQ8N2K1.
PRIDEiQ8N2K1.

PTM databases

iPTMnetiQ8N2K1.
PhosphoSitePlusiQ8N2K1.

Expressioni

Gene expression databases

BgeeiENSG00000160087.
CleanExiHS_UBE2J2.
ExpressionAtlasiQ8N2K1. baseline and differential.
GenevisibleiQ8N2K1. HS.

Organism-specific databases

HPAiHPA051399.

Interactioni

GO - Molecular functioni

  • ubiquitin protein ligase binding Source: ParkinsonsUK-UCL

Protein-protein interaction databases

BioGridi125598. 15 interactors.
IntActiQ8N2K1. 4 interactors.

Structurei

Secondary structure

1259
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Helixi13 – 26Combined sources14
Beta strandi32 – 37Combined sources6
Beta strandi40 – 49Combined sources10
Turni55 – 58Combined sources4
Beta strandi60 – 66Combined sources7
Turni69 – 72Combined sources4
Beta strandi77 – 80Combined sources4
Beta strandi85 – 87Combined sources3
Helixi111 – 123Combined sources13
Helixi136 – 151Combined sources16
Helixi154 – 159Combined sources6
Helixi161 – 167Combined sources7

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2F4WX-ray2.00A/B1-185[»]
ProteinModelPortaliQ8N2K1.
SMRiQ8N2K1.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ8N2K1.

Family & Domainsi

Sequence similaritiesi

Belongs to the ubiquitin-conjugating enzyme family.PROSITE-ProRule annotation

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

GeneTreeiENSGT00530000063379.
HOGENOMiHOG000170330.
HOVERGENiHBG058434.
InParanoidiQ8N2K1.
KOiK04554.
OMAiVVPDGEM.
OrthoDBiEOG091G0IUT.
PhylomeDBiQ8N2K1.
TreeFamiTF101123.

Family and domain databases

Gene3Di3.10.110.10. 1 hit.
InterProiIPR000608. UBQ-conjugat_E2.
IPR016135. UBQ-conjugating_enzyme/RWD.
[Graphical view]
PfamiPF00179. UQ_con. 1 hit.
[Graphical view]
SUPFAMiSSF54495. SSF54495. 1 hit.
PROSITEiPS50127. UBIQUITIN_CONJUGAT_2. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8N2K1-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSSTSSKRAP TTATQRLKQD YLRIKKDPVP YICAEPLPSN ILEWHYVVRG
60 70 80 90 100
PEMTPYEGGY YHGKLIFPRE FPFKPPSIYM ITPNGRFKCN TRLCLSITDF
110 120 130 140 150
HPDTWNPAWS VSTILTGLLS FMVEKGPTLG SIETSDFTKR QLAVQSLAFN
160 170 180 190 200
LKDKVFCELF PEVVEEIKQK QKAQDELSSR PQTLPLPDVV PDGETHLVQN
210 220 230 240 250
GIQLLNGHAP GAVPNLAGLQ QANRHHGLLG GALANLFVIV GFAAFAYTVK

YVLRSIAQE
Length:259
Mass (Da):28,898
Last modified:July 7, 2009 - v3
Checksum:i7DB5280D2947CE7E
GO
Isoform 2 (identifier: Q8N2K1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-44: MSSTSSKRAPTTATQRLKQDYLRIKKDPVPYICAEPLPSNILEW → MWPQDIAGR

Note: No experimental confirmation available.
Show »
Length:224
Mass (Da):24,937
Checksum:iD5E649B09D7CC30E
GO
Isoform 3 (identifier: Q8N2K1-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     44-44: W → WFKRFSWLSLLSSWDYR

Note: No experimental confirmation available.
Show »
Length:275
Mass (Da):30,972
Checksum:i602B2575ABC79E4E
GO

Sequence cautioni

The sequence BM544827 differs from that shown.Curated
The sequence BM544827 differs from that shown. Reason: Frameshift at several positions.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti2S → N in BAC11355 (PubMed:14702039).Curated1
Sequence conflicti100F → S in BAC11355 (PubMed:14702039).Curated1
Sequence conflicti214 – 238PNLAG…ANLFV → QTSQGSSRPTGTTDSGWRPG ELVC in AAK52609 (PubMed:11278356).CuratedAdd BLAST25

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0115721 – 44MSSTS…NILEW → MWPQDIAGR in isoform 2. 1 PublicationAdd BLAST44
Alternative sequenceiVSP_04521944W → WFKRFSWLSLLSSWDYR in isoform 3. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF296658 mRNA. Translation: AAK52609.1.
AK056065 mRNA. Translation: BAB71086.1.
AK075017 mRNA. Translation: BAC11355.1.
AK291935 mRNA. Translation: BAF84624.1.
AL162741 Genomic DNA. Translation: CAI23257.1.
CH471183 Genomic DNA. Translation: EAW56256.1.
CH471183 Genomic DNA. Translation: EAW56259.1.
BC094777 mRNA. Translation: AAH94777.1.
BC104890 mRNA. Translation: AAI04891.1.
BC113430 mRNA. Translation: AAI13431.1.
BC143657 mRNA. Translation: AAI43658.1.
BM544827 mRNA. No translation available.
CCDSiCCDS14.1. [Q8N2K1-1]
CCDS15.1. [Q8N2K1-3]
RefSeqiNP_477515.2. NM_058167.2. [Q8N2K1-1]
NP_919296.1. NM_194315.1. [Q8N2K1-3]
NP_919440.1. NM_194458.1.
XP_005244775.1. XM_005244718.3. [Q8N2K1-1]
XP_005244776.1. XM_005244719.4. [Q8N2K1-1]
XP_006710396.1. XM_006710333.3. [Q8N2K1-1]
XP_011538915.1. XM_011540613.2. [Q8N2K1-2]
XP_011538916.1. XM_011540614.2. [Q8N2K1-1]
UniGeneiHs.191987.

Genome annotation databases

EnsembliENST00000349431; ENSP00000305826; ENSG00000160087. [Q8N2K1-1]
ENST00000360466; ENSP00000353653; ENSG00000160087. [Q8N2K1-1]
ENST00000400930; ENSP00000383719; ENSG00000160087. [Q8N2K1-3]
GeneIDi118424.
KEGGihsa:118424.
UCSCiuc001ado.4. human. [Q8N2K1-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF296658 mRNA. Translation: AAK52609.1.
AK056065 mRNA. Translation: BAB71086.1.
AK075017 mRNA. Translation: BAC11355.1.
AK291935 mRNA. Translation: BAF84624.1.
AL162741 Genomic DNA. Translation: CAI23257.1.
CH471183 Genomic DNA. Translation: EAW56256.1.
CH471183 Genomic DNA. Translation: EAW56259.1.
BC094777 mRNA. Translation: AAH94777.1.
BC104890 mRNA. Translation: AAI04891.1.
BC113430 mRNA. Translation: AAI13431.1.
BC143657 mRNA. Translation: AAI43658.1.
BM544827 mRNA. No translation available.
CCDSiCCDS14.1. [Q8N2K1-1]
CCDS15.1. [Q8N2K1-3]
RefSeqiNP_477515.2. NM_058167.2. [Q8N2K1-1]
NP_919296.1. NM_194315.1. [Q8N2K1-3]
NP_919440.1. NM_194458.1.
XP_005244775.1. XM_005244718.3. [Q8N2K1-1]
XP_005244776.1. XM_005244719.4. [Q8N2K1-1]
XP_006710396.1. XM_006710333.3. [Q8N2K1-1]
XP_011538915.1. XM_011540613.2. [Q8N2K1-2]
XP_011538916.1. XM_011540614.2. [Q8N2K1-1]
UniGeneiHs.191987.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2F4WX-ray2.00A/B1-185[»]
ProteinModelPortaliQ8N2K1.
SMRiQ8N2K1.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi125598. 15 interactors.
IntActiQ8N2K1. 4 interactors.

PTM databases

iPTMnetiQ8N2K1.
PhosphoSitePlusiQ8N2K1.

Polymorphism and mutation databases

BioMutaiUBE2J2.
DMDMi251757431.

Proteomic databases

EPDiQ8N2K1.
MaxQBiQ8N2K1.
PeptideAtlasiQ8N2K1.
PRIDEiQ8N2K1.

Protocols and materials databases

DNASUi118424.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000349431; ENSP00000305826; ENSG00000160087. [Q8N2K1-1]
ENST00000360466; ENSP00000353653; ENSG00000160087. [Q8N2K1-1]
ENST00000400930; ENSP00000383719; ENSG00000160087. [Q8N2K1-3]
GeneIDi118424.
KEGGihsa:118424.
UCSCiuc001ado.4. human. [Q8N2K1-1]

Organism-specific databases

CTDi118424.
GeneCardsiUBE2J2.
H-InvDBHIX0000017.
HGNCiHGNC:19268. UBE2J2.
HPAiHPA051399.
neXtProtiNX_Q8N2K1.
OpenTargetsiENSG00000160087.
PharmGKBiPA134882268.
GenAtlasiSearch...

Phylogenomic databases

GeneTreeiENSGT00530000063379.
HOGENOMiHOG000170330.
HOVERGENiHBG058434.
InParanoidiQ8N2K1.
KOiK04554.
OMAiVVPDGEM.
OrthoDBiEOG091G0IUT.
PhylomeDBiQ8N2K1.
TreeFamiTF101123.

Enzyme and pathway databases

UniPathwayiUPA00143.
BioCyciZFISH:HS08445-MONOMER.
ReactomeiR-HSA-983168. Antigen processing: Ubiquitination & Proteasome degradation.
SignaLinkiQ8N2K1.

Miscellaneous databases

ChiTaRSiUBE2J2. human.
EvolutionaryTraceiQ8N2K1.
GenomeRNAii118424.
PROiQ8N2K1.

Gene expression databases

BgeeiENSG00000160087.
CleanExiHS_UBE2J2.
ExpressionAtlasiQ8N2K1. baseline and differential.
GenevisibleiQ8N2K1. HS.

Family and domain databases

Gene3Di3.10.110.10. 1 hit.
InterProiIPR000608. UBQ-conjugat_E2.
IPR016135. UBQ-conjugating_enzyme/RWD.
[Graphical view]
PfamiPF00179. UQ_con. 1 hit.
[Graphical view]
SUPFAMiSSF54495. SSF54495. 1 hit.
PROSITEiPS50127. UBIQUITIN_CONJUGAT_2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiUB2J2_HUMAN
AccessioniPrimary (citable) accession number: Q8N2K1
Secondary accession number(s): A8MYC7
, Q504T9, Q96N26, Q96T84
Entry historyi
Integrated into UniProtKB/Swiss-Prot: September 13, 2004
Last sequence update: July 7, 2009
Last modified: November 2, 2016
This is version 131 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.