Reviewed,
UniProtKB/Swiss-Prot Q8N2K1 (UB2J2_HUMAN)
Last modified
April 14, 2009.
Version 59.
History...
Clusters with 100%,
90%,
50% identity |
Documents (3) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Ubiquitin-conjugating enzyme E2 J2 EC=6.3.2.19 Alternative name(s): Non-canonical ubiquitin-conjugating enzyme 2 Short name=NCUBE2 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 259 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | Catalyzes the covalent attachment of ubiquitin to other proteins. Seems to function in the selective degradation of misfolded membrane proteins from the endoplasmic reticulum By similarity. |
| Catalytic activity | ATP + ubiquitin + protein lysine = AMP + diphosphate + protein N-ubiquityllysine. |
| Pathway | |
| Subcellular location | Endoplasmic reticulum membrane; Single-pass type IV membrane protein By similarity. |
| Sequence similarities | Belongs to the ubiquitin-conjugating enzyme family. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Ubl conjugation pathway |
| Cellular component | Endoplasmic reticulum Membrane |
| Coding sequence diversity | Alternative splicing |
| Domain | Transmembrane |
| Molecular function | Ligase |
| Technical term | 3D-structure |
| Gene Ontology (GO) | |
| Biological process | modification-dependent protein catabolic process Inferred from electronic annotation. Source: UniProtKB-KW post-translational protein modificationInferred from electronic annotation. Source: InterPro regulation of protein metabolic processInferred from electronic annotation. Source: InterPro |
| Cellular component | endoplasmic reticulum membrane Inferred from electronic annotation. Source: UniProtKB-SubCell integral to membraneInferred from electronic annotation. Source: UniProtKB-KW |
| Molecular function | ubiquitin-protein ligase activity Inferred from electronic annotation. Source: EC |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q8N2K1-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q8N2K1-2) The sequence of this isoform differs from the canonical sequence as follows: 1-44: MNSTSSKRAPTTATQRLKQDYLRIKKDPVPYICAEPLPSNILEW → MWPQDIAGR | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 259 | 259 | Ubiquitin-conjugating enzyme E2 J2 | PRO_0000082596 | |||||||||||||||||||||||||||||
Regions | |||||||||||||||||||||||||||||||||
| Topological domain | 1 – 226 | 226 | Cytoplasmic Potential | ||||||||||||||||||||||||||||||
| Transmembrane | 227 – 247 | 21 | Anchor for type IV membrane protein Potential | ||||||||||||||||||||||||||||||
| Topological domain | 248 – 259 | 12 | Lumenal Potential | ||||||||||||||||||||||||||||||
Sites | |||||||||||||||||||||||||||||||||
| Active site | 94 | 1 | Glycyl thioester intermediate By similarity | ||||||||||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 44 | 44 | MNSTS…NILEW → MWPQDIAGR in isoform 2. | VSP_011572 | |||||||||||||||||||||||||||||
Experimental info | |||||||||||||||||||||||||||||||||
| Sequence conflict | 2 | 1 | N → S in AAK52609. Ref.1 | ||||||||||||||||||||||||||||||
| Sequence conflict | 100 | 1 | F → S in BAC11355. Ref.2 | ||||||||||||||||||||||||||||||
| Sequence conflict | 214 – 238 | 25 | PNLAG…ANLFV → QTSQGSSRPTGTTDSGWRPG ELVC in AAK52609. Ref.1 | ||||||||||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||||||||||
| Helix | 13 – 26 | 14 | |||||||||||||||||||||||||||||||
| Beta strand | 32 – 37 | 6 | |||||||||||||||||||||||||||||||
| Beta strand | 40 – 49 | 10 | |||||||||||||||||||||||||||||||
| Turn | 55 – 58 | 4 | |||||||||||||||||||||||||||||||
| Beta strand | 60 – 66 | 7 | |||||||||||||||||||||||||||||||
| Turn | 69 – 72 | 4 | |||||||||||||||||||||||||||||||
| Beta strand | 77 – 80 | 4 | |||||||||||||||||||||||||||||||
| Beta strand | 85 – 87 | 3 | |||||||||||||||||||||||||||||||
| Helix | 111 – 123 | 13 | |||||||||||||||||||||||||||||||
| Helix | 136 – 151 | 16 | |||||||||||||||||||||||||||||||
| Helix | 154 – 159 | 6 | |||||||||||||||||||||||||||||||
| Helix | 161 – 167 | 7 | |||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Endoplasmic reticulum (ER)-associated degradation of T cell receptor subunits. Involvement of ER-associated ubiquitin-conjugating enzymes (E2s)." Tiwari S., Weissman A.M. J. Biol. Chem. 276:16193-16200(2001) [PubMed: 11278356] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [2] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2). Tissue: Ovary. |
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| AF296658 mRNA. Translation: AAK52609.1. AK056065 mRNA. Translation: BAB71086.1. AK075017 mRNA. Translation: BAC11355.1. | |||||||||||||
| IPI | IPI00455911. IPI00873186. | ||||||||||||
| RefSeq | NP_477515.2. NP_919440.1. | ||||||||||||
| UniGene | Hs.191987 | ||||||||||||
3D structure databases | |||||||||||||
| |||||||||||||
| SMR | Q8N2K1. Positions 11-171. | ||||||||||||
| ModBase | Search... | ||||||||||||
Genome annotation databases | |||||||||||||
| Ensembl | ENSG00000160087. Homo sapiens. [Contig view] | ||||||||||||
| GeneID | 118424. | ||||||||||||
| KEGG | hsa:118424. | ||||||||||||
Organism-specific databases | |||||||||||||
| GeneCards | GC01M001182. | ||||||||||||
| HGNC | HGNC:19268. UBE2J2. | ||||||||||||
| PharmGKB | PA134882268. | ||||||||||||
| GenAtlas | Search... | ||||||||||||
Phylogenomic databases | |||||||||||||
| HOVERGEN | Q8N2K1. | ||||||||||||
Enzyme and pathway databases | |||||||||||||
| BRENDA | 6.3.2.19. 247. | ||||||||||||
Gene expression databases | |||||||||||||
| ArrayExpress | Q8N2K1. | ||||||||||||
| Bgee | Q8N2K1. | ||||||||||||
| CleanEx | HS_UBE2J2. | ||||||||||||
| GermOnline | ENSG00000160087. Homo sapiens. | ||||||||||||
Family and domain databases | |||||||||||||
| InterPro | IPR016135. UBQ-conjugat/RWD-like. IPR000608. UBQ-conjugat_E2. [Graphical view] | ||||||||||||
| Gene3D | G3DSA:3.10.110.10. UBQ-conjugat_E2. 1 hit. | ||||||||||||
| PANTHER | PTHR11621. UBQ-conjugat_E2. 1 hit. | ||||||||||||
| Pfam | PF00179. UQ_con. 1 hit. [Graphical view] | ||||||||||||
| ProDom | PD000461. UBQ_conjugat. 1 hit. [Graphical view] [Entries sharing at least one domain] | ||||||||||||
| SMART | SM00212. UBCc. 1 hit. [Graphical view] | ||||||||||||
| PROSITE | PS00183. UBIQUITIN_CONJUGAT_1. False negative. PS50127. UBIQUITIN_CONJUGAT_2. 1 hit. [Graphical view] | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other Resources | |||||||||||||
| NextBio | 80253. | ||||||||||||
Entry information
| Entry name | UB2J2_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q8N2K1 Secondary accession number(s): Q96N26, Q96T84 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
Relevant documents
| PATHWAY comments Index of metabolic and biosynthesis pathways |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with


