Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q8N2I9

- STK40_HUMAN

UniProt

Q8N2I9 - STK40_HUMAN

Protein

Serine/threonine-protein kinase 40

Gene

STK40

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 104 (01 Oct 2014)
      Sequence version 2 (17 Oct 2006)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    May be a negative regulator of NF-kappa-B and p53-mediated gene transcription.1 Publication

    Catalytic activityi

    ATP + a protein = ADP + a phosphoprotein.

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Binding sitei66 – 661ATPPROSITE-ProRule annotation
    Active sitei196 – 1961Proton acceptorPROSITE-ProRule annotation

    Regions

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Nucleotide bindingi41 – 499ATPPROSITE-ProRule annotation

    GO - Molecular functioni

    1. ATP binding Source: UniProtKB-KW
    2. protein binding Source: UniProtKB
    3. protein serine/threonine kinase activity Source: UniProtKB-KW

    Keywords - Molecular functioni

    Kinase, Serine/threonine-protein kinase, Transferase

    Keywords - Ligandi

    ATP-binding, Nucleotide-binding

    Enzyme and pathway databases

    SignaLinkiQ8N2I9.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Serine/threonine-protein kinase 40 (EC:2.7.11.1)
    Alternative name(s):
    SINK-homologous serine/threonine-protein kinase
    Sugen kinase 495
    Short name:
    SgK495
    Gene namesi
    Name:STK40
    Synonyms:SGK495, SHIK
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 1

    Organism-specific databases

    HGNCiHGNC:21373. STK40.

    Subcellular locationi

    Nucleus 1 Publication. Cytoplasm 1 Publication

    GO - Cellular componenti

    1. cytoplasm Source: HPA
    2. nucleus Source: HPA

    Keywords - Cellular componenti

    Cytoplasm, Nucleus

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA142670860.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 435435Serine/threonine-protein kinase 40PRO_0000252261Add
    BLAST

    Proteomic databases

    MaxQBiQ8N2I9.
    PaxDbiQ8N2I9.
    PRIDEiQ8N2I9.

    Expressioni

    Tissue specificityi

    Strongly expressed in heart, brain, placenta, lung, skeletal muscle, kidney, spleen, thymus, prostate, liver, pancreas, testis, ovary, small intestine, colon and peripheral blood leukocytes.1 Publication

    Gene expression databases

    BgeeiQ8N2I9.
    GenevestigatoriQ8N2I9.

    Organism-specific databases

    HPAiHPA008026.

    Interactioni

    Protein-protein interaction databases

    BioGridi123816. 4 interactions.
    IntActiQ8N2I9. 3 interactions.
    MINTiMINT-1382789.

    Structurei

    3D structure databases

    ProteinModelPortaliQ8N2I9.
    SMRiQ8N2I9. Positions 35-369.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini35 – 331297Protein kinasePROSITE-ProRule annotationAdd
    BLAST

    Sequence similaritiesi

    Contains 1 protein kinase domain.PROSITE-ProRule annotation

    Phylogenomic databases

    eggNOGiCOG0515.
    HOVERGENiHBG080296.
    KOiK16312.
    OMAiGNIPPVR.
    OrthoDBiEOG7W1543.
    PhylomeDBiQ8N2I9.
    TreeFamiTF329785.

    Family and domain databases

    InterProiIPR011009. Kinase-like_dom.
    IPR000719. Prot_kinase_dom.
    IPR024236. Ser/Thr_kinase_40.
    IPR008271. Ser/Thr_kinase_AS.
    IPR024104. Tribbles/Ser_Thr_kinase_40.
    [Graphical view]
    PANTHERiPTHR22961. PTHR22961. 1 hit.
    PTHR22961:SF1. PTHR22961:SF1. 1 hit.
    PfamiPF00069. Pkinase. 1 hit.
    [Graphical view]
    SUPFAMiSSF56112. SSF56112. 1 hit.
    PROSITEiPS50011. PROTEIN_KINASE_DOM. 1 hit.
    PS00108. PROTEIN_KINASE_ST. 1 hit.
    [Graphical view]

    Sequences (4)i

    Sequence statusi: Complete.

    This entry describes 4 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q8N2I9-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MKRRASDRGA GETSARAKAL GSGISGNNAK RAGPFILGPR LGNSPVPSIV    50
    QCLARKDGTD DFYQLKILTL EERGDQGIES QEERQGKMLL HTEYSLLSLL 100
    HTQDGVVHHH GLFQDRTCEI VEDTESSRMV KKMKKRICLV LDCLCAHDFS 150
    DKTADLINLQ HYVIKEKRLS ERETVVIFYD VVRVVEALHQ KNIVHRDLKL 200
    GNMVLNKRTH RITITNFCLG KHLVSEGDLL KDQRGSPAYI SPDVLSGRPY 250
    RGKPSDMWAL GVVLFTMLYG QFPFYDSIPQ ELFRKIKAAE YTIPEDGRVS 300
    ENTVCLIRKL LVLDPQQRLA AADVLEALSA IIASWQSLSS LSGPLQVVPD 350
    IDDQMSNADS SQEAKVTEEC SQYEFENYMR QQLLLAEEKS SIHDARSWVP 400
    KRQFGSAPPV RRLGHDAQPM TSLDTAILAQ RYLRK 435
    Length:435
    Mass (Da):49,001
    Last modified:October 17, 2006 - v2
    Checksum:iEBA7A19963582BCC
    GO
    Isoform 2 (identifier: Q8N2I9-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-262: Missing.
         263-295: VLFTMLYGQFPFYDSIPQELFRKIKAAEYTIPE → MGLRQGNGTVSLGILATDPAPPTEPSSPTPCLR

    Note: No experimental confirmation available.

    Show »
    Length:173
    Mass (Da):18,956
    Checksum:iF219891A6F5C9AE1
    GO
    Isoform 3 (identifier: Q8N2I9-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         364-417: AKVTEECSQY...PPVRRLGHDA → VSWGGQMGHY...GGKGRLQSSA
         418-435: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:417
    Mass (Da):46,393
    Checksum:i33C6B3B9131B8B77
    GO
    Isoform 4 (identifier: Q8N2I9-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         37-37: L → LALCAV

    Note: No experimental confirmation available.

    Show »
    Length:440
    Mass (Da):49,459
    Checksum:i75428BCF0DE3717C
    GO

    Sequence cautioni

    The sequence AAH08344.1 differs from that shown. Reason: Erroneous initiation.
    The sequence BAB15794.1 differs from that shown. Reason: Erroneous initiation.
    The sequence BAC11361.1 differs from that shown. Reason: Erroneous initiation.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti191 – 1911Missing in BAC11371. (PubMed:14702039)Curated
    Sequence conflicti363 – 3631E → Q in AAH05169. (PubMed:15489334)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti10 – 101A → V.1 Publication
    Corresponds to variant rs56314546 [ dbSNP | Ensembl ].
    VAR_041200
    Natural varianti133 – 1331M → T in a colorectal adenocarcinoma sample; somatic mutation. 1 Publication
    VAR_041201
    Natural varianti211 – 2111R → Q in a colorectal adenocarcinoma sample; somatic mutation. 1 Publication
    VAR_041202
    Natural varianti395 – 3951A → T.3 Publications
    Corresponds to variant rs3795498 [ dbSNP | Ensembl ].
    VAR_041203

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 262262Missing in isoform 2. 1 PublicationVSP_020896Add
    BLAST
    Alternative sequencei37 – 371L → LALCAV in isoform 4. 1 PublicationVSP_020897
    Alternative sequencei263 – 29533VLFTM…YTIPE → MGLRQGNGTVSLGILATDPA PPTEPSSPTPCLR in isoform 2. 1 PublicationVSP_020898Add
    BLAST
    Alternative sequencei364 – 41754AKVTE…LGHDA → VSWGGQMGHYPAPRDRLLGA GRARAEVAATRRPQSFLGLL PQPWGGKGRLQSSA in isoform 3. 1 PublicationVSP_020899Add
    BLAST
    Alternative sequencei418 – 43518Missing in isoform 3. 1 PublicationVSP_020900Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AY198395 mRNA. Translation: AAP20040.1.
    AK024504 mRNA. Translation: BAB15794.1. Different initiation.
    AK075029 mRNA. Translation: BAC11361.1. Different initiation.
    AK075048 mRNA. Translation: BAC11371.1.
    AK131560 mRNA. Translation: BAD18694.1.
    AL834137 mRNA. Translation: CAD38852.1.
    AL591845 Genomic DNA. Translation: CAH71862.1.
    AL591845 Genomic DNA. Translation: CAH71863.1.
    AL591845 Genomic DNA. Translation: CAH71864.1.
    CH471059 Genomic DNA. Translation: EAX07371.1.
    CH471059 Genomic DNA. Translation: EAX07373.1.
    BC005169 mRNA. Translation: AAH05169.3.
    BC007835 mRNA. Translation: AAH07835.2.
    BC008344 mRNA. Translation: AAH08344.1. Different initiation.
    CCDSiCCDS407.1. [Q8N2I9-1]
    CCDS60089.1. [Q8N2I9-4]
    RefSeqiNP_001269475.1. NM_001282546.1. [Q8N2I9-4]
    NP_001269476.1. NM_001282547.1. [Q8N2I9-1]
    NP_114406.1. NM_032017.2. [Q8N2I9-1]
    UniGeneiHs.471768.

    Genome annotation databases

    EnsembliENST00000359297; ENSP00000352245; ENSG00000196182. [Q8N2I9-3]
    ENST00000373129; ENSP00000362221; ENSG00000196182. [Q8N2I9-1]
    ENST00000373130; ENSP00000362222; ENSG00000196182. [Q8N2I9-4]
    ENST00000373132; ENSP00000362224; ENSG00000196182. [Q8N2I9-1]
    GeneIDi83931.
    KEGGihsa:83931.
    UCSCiuc001cak.1. human. [Q8N2I9-1]
    uc001cal.1. human. [Q8N2I9-4]
    uc001can.1. human. [Q8N2I9-3]

    Polymorphism databases

    DMDMi116256080.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AY198395 mRNA. Translation: AAP20040.1 .
    AK024504 mRNA. Translation: BAB15794.1 . Different initiation.
    AK075029 mRNA. Translation: BAC11361.1 . Different initiation.
    AK075048 mRNA. Translation: BAC11371.1 .
    AK131560 mRNA. Translation: BAD18694.1 .
    AL834137 mRNA. Translation: CAD38852.1 .
    AL591845 Genomic DNA. Translation: CAH71862.1 .
    AL591845 Genomic DNA. Translation: CAH71863.1 .
    AL591845 Genomic DNA. Translation: CAH71864.1 .
    CH471059 Genomic DNA. Translation: EAX07371.1 .
    CH471059 Genomic DNA. Translation: EAX07373.1 .
    BC005169 mRNA. Translation: AAH05169.3 .
    BC007835 mRNA. Translation: AAH07835.2 .
    BC008344 mRNA. Translation: AAH08344.1 . Different initiation.
    CCDSi CCDS407.1. [Q8N2I9-1 ]
    CCDS60089.1. [Q8N2I9-4 ]
    RefSeqi NP_001269475.1. NM_001282546.1. [Q8N2I9-4 ]
    NP_001269476.1. NM_001282547.1. [Q8N2I9-1 ]
    NP_114406.1. NM_032017.2. [Q8N2I9-1 ]
    UniGenei Hs.471768.

    3D structure databases

    ProteinModelPortali Q8N2I9.
    SMRi Q8N2I9. Positions 35-369.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 123816. 4 interactions.
    IntActi Q8N2I9. 3 interactions.
    MINTi MINT-1382789.

    Polymorphism databases

    DMDMi 116256080.

    Proteomic databases

    MaxQBi Q8N2I9.
    PaxDbi Q8N2I9.
    PRIDEi Q8N2I9.

    Protocols and materials databases

    DNASUi 83931.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000359297 ; ENSP00000352245 ; ENSG00000196182 . [Q8N2I9-3 ]
    ENST00000373129 ; ENSP00000362221 ; ENSG00000196182 . [Q8N2I9-1 ]
    ENST00000373130 ; ENSP00000362222 ; ENSG00000196182 . [Q8N2I9-4 ]
    ENST00000373132 ; ENSP00000362224 ; ENSG00000196182 . [Q8N2I9-1 ]
    GeneIDi 83931.
    KEGGi hsa:83931.
    UCSCi uc001cak.1. human. [Q8N2I9-1 ]
    uc001cal.1. human. [Q8N2I9-4 ]
    uc001can.1. human. [Q8N2I9-3 ]

    Organism-specific databases

    CTDi 83931.
    GeneCardsi GC01M036805.
    HGNCi HGNC:21373. STK40.
    HPAi HPA008026.
    MIMi 609437. gene.
    neXtProti NX_Q8N2I9.
    PharmGKBi PA142670860.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG0515.
    HOVERGENi HBG080296.
    KOi K16312.
    OMAi GNIPPVR.
    OrthoDBi EOG7W1543.
    PhylomeDBi Q8N2I9.
    TreeFami TF329785.

    Enzyme and pathway databases

    SignaLinki Q8N2I9.

    Miscellaneous databases

    ChiTaRSi STK40. human.
    GeneWikii STK40.
    GenomeRNAii 83931.
    NextBioi 73043.
    PROi Q8N2I9.
    SOURCEi Search...

    Gene expression databases

    Bgeei Q8N2I9.
    Genevestigatori Q8N2I9.

    Family and domain databases

    InterProi IPR011009. Kinase-like_dom.
    IPR000719. Prot_kinase_dom.
    IPR024236. Ser/Thr_kinase_40.
    IPR008271. Ser/Thr_kinase_AS.
    IPR024104. Tribbles/Ser_Thr_kinase_40.
    [Graphical view ]
    PANTHERi PTHR22961. PTHR22961. 1 hit.
    PTHR22961:SF1. PTHR22961:SF1. 1 hit.
    Pfami PF00069. Pkinase. 1 hit.
    [Graphical view ]
    SUPFAMi SSF56112. SSF56112. 1 hit.
    PROSITEi PS50011. PROTEIN_KINASE_DOM. 1 hit.
    PS00108. PROTEIN_KINASE_ST. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Cloning and characterization of a novel Ser/Thr-like kinase."
      Shan Y.X., Wu H., Yu L.
      Submitted (DEC-2002) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
      Tissue: Brain.
    2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2 AND 3), VARIANT THR-395.
      Tissue: Ovary, Spleen and Testis.
    3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Melanoma.
    4. "The DNA sequence and biological annotation of human chromosome 1."
      Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K.
      , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
      Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 4), VARIANT THR-395.
      Tissue: Kidney and Muscle.
    7. Cited for: IDENTIFICATION.
    8. "Identification of a novel serine/threonine kinase that inhibits TNF-induced NF-kappaB activation and p53-induced transcription."
      Huang J., Teng L., Liu T., Li L., Chen D., Li F., Xu L.-G., Zhai Z., Shu H.-B.
      Biochem. Biophys. Res. Commun. 309:774-778(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
    9. "Patterns of somatic mutation in human cancer genomes."
      Greenman C., Stephens P., Smith R., Dalgliesh G.L., Hunter C., Bignell G., Davies H., Teague J., Butler A., Stevens C., Edkins S., O'Meara S., Vastrik I., Schmidt E.E., Avis T., Barthorpe S., Bhamra G., Buck G.
      , Choudhury B., Clements J., Cole J., Dicks E., Forbes S., Gray K., Halliday K., Harrison R., Hills K., Hinton J., Jenkinson A., Jones D., Menzies A., Mironenko T., Perry J., Raine K., Richardson D., Shepherd R., Small A., Tofts C., Varian J., Webb T., West S., Widaa S., Yates A., Cahill D.P., Louis D.N., Goldstraw P., Nicholson A.G., Brasseur F., Looijenga L., Weber B.L., Chiew Y.-E., DeFazio A., Greaves M.F., Green A.R., Campbell P., Birney E., Easton D.F., Chenevix-Trench G., Tan M.-H., Khoo S.K., Teh B.T., Yuen S.T., Leung S.Y., Wooster R., Futreal P.A., Stratton M.R.
      Nature 446:153-158(2007) [PubMed] [Europe PMC] [Abstract]
      Cited for: VARIANTS [LARGE SCALE ANALYSIS] VAL-10; THR-133; GLN-211 AND THR-395.

    Entry informationi

    Entry nameiSTK40_HUMAN
    AccessioniPrimary (citable) accession number: Q8N2I9
    Secondary accession number(s): D3DPS8
    , Q5VTK8, Q5VTK9, Q6ZMN1, Q8N2J8, Q8N3I6, Q96HN6, Q96I44, Q9BSA3, Q9H7H6
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: October 17, 2006
    Last sequence update: October 17, 2006
    Last modified: October 1, 2014
    This is version 104 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 1
      Human chromosome 1: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. Human and mouse protein kinases
      Human and mouse protein kinases: classification and index
    6. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3