Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Serine/threonine-protein kinase 40

Gene

STK40

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

May be a negative regulator of NF-kappa-B and p53-mediated gene transcription.1 Publication

Catalytic activityi

ATP + a protein = ADP + a phosphoprotein.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Binding sitei66ATPPROSITE-ProRule annotation1
Active sitei196Proton acceptorPROSITE-ProRule annotation1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Nucleotide bindingi41 – 49ATPPROSITE-ProRule annotation9

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionKinase, Serine/threonine-protein kinase, Transferase
LigandATP-binding, Nucleotide-binding

Enzyme and pathway databases

SignaLinkiQ8N2I9.

Names & Taxonomyi

Protein namesi
Recommended name:
Serine/threonine-protein kinase 40 (EC:2.7.11.1)
Alternative name(s):
SINK-homologous serine/threonine-protein kinase
Sugen kinase 495
Short name:
SgK495
Gene namesi
Name:STK40
Synonyms:SGK495, SHIK
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

HGNCiHGNC:21373. STK40.

Subcellular locationi

GO - Cellular componenti

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Organism-specific databases

DisGeNETi83931.
OpenTargetsiENSG00000196182.
PharmGKBiPA142670860.

Polymorphism and mutation databases

BioMutaiSTK40.
DMDMi116256080.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002522611 – 435Serine/threonine-protein kinase 40Add BLAST435

Proteomic databases

MaxQBiQ8N2I9.
PaxDbiQ8N2I9.
PeptideAtlasiQ8N2I9.
PRIDEiQ8N2I9.

PTM databases

iPTMnetiQ8N2I9.
PhosphoSitePlusiQ8N2I9.

Expressioni

Tissue specificityi

Strongly expressed in heart, brain, placenta, lung, skeletal muscle, kidney, spleen, thymus, prostate, liver, pancreas, testis, ovary, small intestine, colon and peripheral blood leukocytes.1 Publication

Gene expression databases

BgeeiENSG00000196182.
GenevisibleiQ8N2I9. HS.

Organism-specific databases

HPAiHPA008026.

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
TRIB1Q96RU82EBI-716112,EBI-492555

Protein-protein interaction databases

BioGridi123816. 23 interactors.
IntActiQ8N2I9. 8 interactors.
MINTiMINT-1382789.
STRINGi9606.ENSP00000362221.

Structurei

Secondary structure

1435
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Beta strandi49 – 52Combined sources4
Turni57 – 59Combined sources3
Beta strandi64 – 69Combined sources6
Helixi81 – 97Combined sources17
Helixi98 – 100Combined sources3
Beta strandi109 – 115Combined sources7
Beta strandi124 – 126Combined sources3
Beta strandi128 – 130Combined sources3
Beta strandi136 – 141Combined sources6
Helixi152 – 155Combined sources4
Helixi159 – 164Combined sources6
Beta strandi165 – 168Combined sources4
Helixi171 – 190Combined sources20
Helixi200 – 202Combined sources3
Beta strandi203 – 205Combined sources3
Turni207 – 209Combined sources3
Beta strandi212 – 214Combined sources3
Turni237 – 239Combined sources3
Helixi242 – 245Combined sources4
Helixi252 – 269Combined sources18
Helixi279 – 288Combined sources10
Helixi301 – 310Combined sources10
Beta strandi315 – 318Combined sources4
Helixi321 – 333Combined sources13

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
5L2QX-ray2.53A/B/C/D22-339[»]
ProteinModelPortaliQ8N2I9.
SMRiQ8N2I9.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini35 – 331Protein kinasePROSITE-ProRule annotationAdd BLAST297

Sequence similaritiesi

Phylogenomic databases

eggNOGiKOG0583. Eukaryota.
COG0515. LUCA.
GeneTreeiENSGT00880000137914.
HOVERGENiHBG080296.
InParanoidiQ8N2I9.
KOiK16312.
OMAiPFILGPR.
OrthoDBiEOG091G0AGV.
PhylomeDBiQ8N2I9.
TreeFamiTF329785.

Family and domain databases

CDDicd13974. STKc_SHIK. 1 hit.
InterProiView protein in InterPro
IPR011009. Kinase-like_dom.
IPR000719. Prot_kinase_dom.
IPR024236. Ser/Thr_kinase_40.
IPR008271. Ser/Thr_kinase_AS.
IPR024104. Tribbles/Ser_Thr_kinase_40.
PANTHERiPTHR22961. PTHR22961. 1 hit.
PfamiView protein in Pfam
PF00069. Pkinase. 1 hit.
SMARTiView protein in SMART
SM00220. S_TKc. 1 hit.
SUPFAMiSSF56112. SSF56112. 1 hit.
PROSITEiView protein in PROSITE
PS50011. PROTEIN_KINASE_DOM. 1 hit.
PS00108. PROTEIN_KINASE_ST. 1 hit.

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8N2I9-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MKRRASDRGA GETSARAKAL GSGISGNNAK RAGPFILGPR LGNSPVPSIV
60 70 80 90 100
QCLARKDGTD DFYQLKILTL EERGDQGIES QEERQGKMLL HTEYSLLSLL
110 120 130 140 150
HTQDGVVHHH GLFQDRTCEI VEDTESSRMV KKMKKRICLV LDCLCAHDFS
160 170 180 190 200
DKTADLINLQ HYVIKEKRLS ERETVVIFYD VVRVVEALHQ KNIVHRDLKL
210 220 230 240 250
GNMVLNKRTH RITITNFCLG KHLVSEGDLL KDQRGSPAYI SPDVLSGRPY
260 270 280 290 300
RGKPSDMWAL GVVLFTMLYG QFPFYDSIPQ ELFRKIKAAE YTIPEDGRVS
310 320 330 340 350
ENTVCLIRKL LVLDPQQRLA AADVLEALSA IIASWQSLSS LSGPLQVVPD
360 370 380 390 400
IDDQMSNADS SQEAKVTEEC SQYEFENYMR QQLLLAEEKS SIHDARSWVP
410 420 430
KRQFGSAPPV RRLGHDAQPM TSLDTAILAQ RYLRK
Length:435
Mass (Da):49,001
Last modified:October 17, 2006 - v2
Checksum:iEBA7A19963582BCC
GO
Isoform 2 (identifier: Q8N2I9-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-262: Missing.
     263-295: VLFTMLYGQFPFYDSIPQELFRKIKAAEYTIPE → MGLRQGNGTVSLGILATDPAPPTEPSSPTPCLR

Note: No experimental confirmation available.
Show »
Length:173
Mass (Da):18,956
Checksum:iF219891A6F5C9AE1
GO
Isoform 3 (identifier: Q8N2I9-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     364-417: AKVTEECSQY...PPVRRLGHDA → VSWGGQMGHY...GGKGRLQSSA
     418-435: Missing.

Note: No experimental confirmation available.
Show »
Length:417
Mass (Da):46,393
Checksum:i33C6B3B9131B8B77
GO
Isoform 4 (identifier: Q8N2I9-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     37-37: L → LALCAV

Note: No experimental confirmation available.
Show »
Length:440
Mass (Da):49,459
Checksum:i75428BCF0DE3717C
GO

Sequence cautioni

The sequence AAH08344 differs from that shown. Reason: Erroneous initiation.Curated
The sequence BAB15794 differs from that shown. Reason: Erroneous initiation.Curated
The sequence BAC11361 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti191Missing in BAC11371 (PubMed:14702039).Curated1
Sequence conflicti363E → Q in AAH05169 (PubMed:15489334).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_04120010A → V1 PublicationCorresponds to variant dbSNP:rs56314546Ensembl.1
Natural variantiVAR_041201133M → T in a colorectal adenocarcinoma sample; somatic mutation. 1 PublicationCorresponds to variant dbSNP:rs755089893Ensembl.1
Natural variantiVAR_041202211R → Q in a colorectal adenocarcinoma sample; somatic mutation. 1 PublicationCorresponds to variant dbSNP:rs539738963Ensembl.1
Natural variantiVAR_041203395A → T3 PublicationsCorresponds to variant dbSNP:rs3795498Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0208961 – 262Missing in isoform 2. 1 PublicationAdd BLAST262
Alternative sequenceiVSP_02089737L → LALCAV in isoform 4. 1 Publication1
Alternative sequenceiVSP_020898263 – 295VLFTM…YTIPE → MGLRQGNGTVSLGILATDPA PPTEPSSPTPCLR in isoform 2. 1 PublicationAdd BLAST33
Alternative sequenceiVSP_020899364 – 417AKVTE…LGHDA → VSWGGQMGHYPAPRDRLLGA GRARAEVAATRRPQSFLGLL PQPWGGKGRLQSSA in isoform 3. 1 PublicationAdd BLAST54
Alternative sequenceiVSP_020900418 – 435Missing in isoform 3. 1 PublicationAdd BLAST18

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY198395 mRNA. Translation: AAP20040.1.
AK024504 mRNA. Translation: BAB15794.1. Different initiation.
AK075029 mRNA. Translation: BAC11361.1. Different initiation.
AK075048 mRNA. Translation: BAC11371.1.
AK131560 mRNA. Translation: BAD18694.1.
AL834137 mRNA. Translation: CAD38852.1.
AL591845 Genomic DNA. Translation: CAH71862.1.
AL591845 Genomic DNA. Translation: CAH71863.1.
AL591845 Genomic DNA. Translation: CAH71864.1.
CH471059 Genomic DNA. Translation: EAX07371.1.
CH471059 Genomic DNA. Translation: EAX07373.1.
BC005169 mRNA. Translation: AAH05169.3.
BC007835 mRNA. Translation: AAH07835.2.
BC008344 mRNA. Translation: AAH08344.1. Different initiation.
CCDSiCCDS407.1. [Q8N2I9-1]
CCDS60089.1. [Q8N2I9-4]
RefSeqiNP_001269475.1. NM_001282546.1. [Q8N2I9-4]
NP_001269476.1. NM_001282547.1. [Q8N2I9-1]
NP_114406.1. NM_032017.2. [Q8N2I9-1]
UniGeneiHs.471768.

Genome annotation databases

EnsembliENST00000359297; ENSP00000352245; ENSG00000196182. [Q8N2I9-3]
ENST00000373129; ENSP00000362221; ENSG00000196182. [Q8N2I9-1]
ENST00000373130; ENSP00000362222; ENSG00000196182. [Q8N2I9-4]
ENST00000373132; ENSP00000362224; ENSG00000196182. [Q8N2I9-1]
GeneIDi83931.
KEGGihsa:83931.
UCSCiuc001cak.3. human. [Q8N2I9-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiSTK40_HUMAN
AccessioniPrimary (citable) accession number: Q8N2I9
Secondary accession number(s): D3DPS8
, Q5VTK8, Q5VTK9, Q6ZMN1, Q8N2J8, Q8N3I6, Q96HN6, Q96I44, Q9BSA3, Q9H7H6
Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 17, 2006
Last sequence update: October 17, 2006
Last modified: August 30, 2017
This is version 131 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. Human and mouse protein kinases
    Human and mouse protein kinases: classification and index
  7. SIMILARITY comments
    Index of protein domains and families