Q8N2I9 (STK40_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 92.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Serine/threonine-protein kinase 40 EC=2.7.11.1 Alternative name(s): SINK-homologous serine/threonine-protein kinase Sugen kinase 495 Short name=SgK495 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 435 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Function | May be a negative regulator of NF-kappa-B and p53-mediated gene transcription. Ref.8 |
| Catalytic activity | ATP + a protein = ADP + a phosphoprotein. |
| Subcellular location | |
| Tissue specificity | Strongly expressed in heart, brain, placenta, lung, skeletal muscle, kidney, spleen, thymus, prostate, liver, pancreas, testis, ovary, small intestine, colon and peripheral blood leukocytes. Ref.8 |
| Sequence similarities | Belongs to the protein kinase superfamily. CAMK Ser/Thr protein kinase family. Contains 1 protein kinase domain. |
| Sequence caution | The sequence AAH08344.1 differs from that shown. Reason: Erroneous initiation. The sequence BAB15794.1 differs from that shown. Reason: Erroneous initiation. The sequence BAC11361.1 differs from that shown. Reason: Erroneous initiation. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cytoplasm Nucleus |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Ligand | ATP-binding Nucleotide-binding |
| Molecular function | Kinase Serine/threonine-protein kinase Transferase |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Cellular_component | cytoplasm Inferred from direct assay. Source: HPA nucleusInferred from direct assay. Source: HPA |
| Molecular_function | ATP binding Inferred from electronic annotation. Source: UniProtKB-KW protein serine/threonine kinase activityInferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q8N2I9-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q8N2I9-2) The sequence of this isoform differs from the canonical sequence as follows: 1-262: Missing. 263-295: VLFTMLYGQFPFYDSIPQELFRKIKAAEYTIPE → MGLRQGNGTVSLGILATDPAPPTEPSSPTPCLR | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: Q8N2I9-3) The sequence of this isoform differs from the canonical sequence as follows: 364-417: AKVTEECSQY...PPVRRLGHDA → VSWGGQMGHY...GGKGRLQSSA 418-435: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 4 (identifier: Q8N2I9-4) The sequence of this isoform differs from the canonical sequence as follows: 37-37: L → LALCAV | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 435 | 435 | Serine/threonine-protein kinase 40 | PRO_0000252261 | |||||
Regions | |||||||||
| Domain | 35 – 331 | 297 | Protein kinase | ||||||
| Nucleotide binding | 41 – 49 | 9 | ATP By similarity | ||||||
Sites | |||||||||
| Active site | 196 | 1 | Proton acceptor By similarity | ||||||
| Binding site | 66 | 1 | ATP By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 262 | 262 | Missing in isoform 2. | VSP_020896 | |||||
| Alternative sequence | 37 | 1 | L → LALCAV in isoform 4. | VSP_020897 | |||||
| Alternative sequence | 263 – 295 | 33 | VLFTM…YTIPE → MGLRQGNGTVSLGILATDPA PPTEPSSPTPCLR in isoform 2. | VSP_020898 | |||||
| Alternative sequence | 364 – 417 | 54 | AKVTE…LGHDA → VSWGGQMGHYPAPRDRLLGA GRARAEVAATRRPQSFLGLL PQPWGGKGRLQSSA in isoform 3. | VSP_020899 | |||||
| Alternative sequence | 418 – 435 | 18 | Missing in isoform 3. | VSP_020900 | |||||
| Natural variant | 10 | 1 | A → V. Ref.9 Corresponds to variant rs56314546 [ dbSNP | Ensembl ]. | VAR_041200 | |||||
| Natural variant | 133 | 1 | M → T in a colorectal adenocarcinoma sample; somatic mutation. Ref.9 | VAR_041201 | |||||
| Natural variant | 211 | 1 | R → Q in a colorectal adenocarcinoma sample; somatic mutation. Ref.9 | VAR_041202 | |||||
| Natural variant | 395 | 1 | A → T. Ref.2 Ref.6 Ref.9 Corresponds to variant rs3795498 [ dbSNP | Ensembl ]. | VAR_041203 | |||||
Experimental info | |||||||||
| Sequence conflict | 191 | 1 | Missing in BAC11371. Ref.2 | ||||||
| Sequence conflict | 363 | 1 | E → Q in AAH05169. Ref.6 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Cloning and characterization of a novel Ser/Thr-like kinase." Shan Y.X., Wu H., Yu L. Submitted (DEC-2002) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Brain. |
| [2] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2 AND 3), VARIANT THR-395. Tissue: Ovary, Spleen and Testis. |
| [3] | "The full-ORF clone resource of the German cDNA consortium." Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I. BMC Genomics 8:399-399(2007) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Melanoma. |
| [4] | "The DNA sequence and biological annotation of human chromosome 1." Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K. Bentley D.R.Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 4), VARIANT THR-395. Tissue: Kidney and Muscle. |
| [7] | "The protein kinase complement of the human genome." Manning G., Whyte D.B., Martinez R., Hunter T., Sudarsanam S. Science 298:1912-1934(2002) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION. |
| [8] | "Identification of a novel serine/threonine kinase that inhibits TNF-induced NF-kappaB activation and p53-induced transcription." Huang J., Teng L., Liu T., Li L., Chen D., Li F., Xu L.-G., Zhai Z., Shu H.-B. Biochem. Biophys. Res. Commun. 309:774-778(2003) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY. |
| [9] | "Patterns of somatic mutation in human cancer genomes." Greenman C., Stephens P., Smith R., Dalgliesh G.L., Hunter C., Bignell G., Davies H., Teague J., Butler A., Stevens C., Edkins S., O'Meara S., Vastrik I., Schmidt E.E., Avis T., Barthorpe S., Bhamra G., Buck G. Stratton M.R.Nature 446:153-158(2007) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS [LARGE SCALE ANALYSIS] VAL-10; THR-133; GLN-211 AND THR-395. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AY198395 mRNA. Translation: AAP20040.1. AK024504 mRNA. Translation: BAB15794.1. Different initiation. AK075029 mRNA. Translation: BAC11361.1. Different initiation. AK075048 mRNA. Translation: BAC11371.1. AK131560 mRNA. Translation: BAD18694.1. AL834137 mRNA. Translation: CAD38852.1. AL591845 Genomic DNA. Translation: CAH71862.1. AL591845 Genomic DNA. Translation: CAH71863.1. AL591845 Genomic DNA. Translation: CAH71864.1. CH471059 Genomic DNA. Translation: EAX07371.1. CH471059 Genomic DNA. Translation: EAX07373.1. BC005169 mRNA. Translation: AAH05169.3. BC007835 mRNA. Translation: AAH07835.2. BC008344 mRNA. Translation: AAH08344.1. Different initiation. |
| IPI | IPI00161013. IPI00181701. IPI00644404. IPI00790155. |
| RefSeq | NP_114406.1. NM_032017.1. |
| UniGene | Hs.471768. |
3D structure databases | |
| ProteinModelPortal | Q8N2I9. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q8N2I9. 2 interactions. |
| MINT | MINT-1382789. |
Polymorphism databases | |
| DMDM | 116256080. |
Proteomic databases | |
| PaxDb | Q8N2I9. |
| PRIDE | Q8N2I9. |
Protocols and materials databases | |
| DNASU | 83931. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000359297; ENSP00000352245; ENSG00000196182. ENST00000373129; ENSP00000362221; ENSG00000196182. ENST00000373130; ENSP00000362222; ENSG00000196182. ENST00000373132; ENSP00000362224; ENSG00000196182. |
| GeneID | 83931. |
| KEGG | hsa:83931. |
| UCSC | uc001cak.1. human. uc001cal.1. human. uc001can.1. human. |
Organism-specific databases | |
| CTD | 83931. |
| GeneCards | GC01M036805. |
| HGNC | HGNC:21373. STK40. |
| HPA | HPA008026. |
| MIM | 609437. gene. |
| neXtProt | NX_Q8N2I9. |
| PharmGKB | PA142670860. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | COG0515. |
| HOVERGEN | HBG080296. |
| KO | K16312. |
| OMA | SSIIASW. |
| OrthoDB | EOG4ZPDV8. |
| PhylomeDB | Q8N2I9. |
Gene expression databases | |
| Bgee | Q8N2I9. |
| Genevestigator | Q8N2I9. |
| GermOnline | ENSG00000196182. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR011009. Kinase-like_dom. IPR000719. Prot_kinase_cat_dom. IPR024236. Ser/Thr_kinase_40. IPR008271. Ser/Thr_kinase_AS. IPR024104. Tribbles/Ser_Thr_kinase_40. [Graphical view] |
| PANTHER | PTHR22961. PTHR22961. 1 hit. PTHR22961:SF1. PTHR22961:SF1. 1 hit. |
| Pfam | PF00069. Pkinase. 1 hit. [Graphical view] |
| SUPFAM | SSF56112. Kinase_like. 1 hit. |
| PROSITE | PS00107. PROTEIN_KINASE_ATP. False negative. PS50011. PROTEIN_KINASE_DOM. 1 hit. PS00108. PROTEIN_KINASE_ST. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChiTaRS | STK40. human. |
| GenomeRNAi | 83931. |
| NextBio | 73043. |
| SOURCE | Search... |
Entry information
| Entry name | STK40_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q8N2I9 Secondary accession number(s): D3DPS8 Q9H7H6 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human and mouse protein kinases Human and mouse protein kinases: classification and index |
| Human chromosome 1 Human chromosome 1: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
