Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q8N2I9 (STK40_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 103. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (6) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Serine/threonine-protein kinase 40

EC=2.7.11.1
Alternative name(s):
SINK-homologous serine/threonine-protein kinase
Sugen kinase 495
Short name=SgK495
Gene names
Name:STK40
Synonyms:SGK495, SHIK
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length435 AA.
Sequence statusComplete.
Protein existenceEvidence at transcript level

General annotation (Comments)

Function

May be a negative regulator of NF-kappa-B and p53-mediated gene transcription. Ref.8

Catalytic activity

ATP + a protein = ADP + a phosphoprotein.

Subcellular location

Nucleus. Cytoplasm Ref.8.

Tissue specificity

Strongly expressed in heart, brain, placenta, lung, skeletal muscle, kidney, spleen, thymus, prostate, liver, pancreas, testis, ovary, small intestine, colon and peripheral blood leukocytes. Ref.8

Sequence similarities

Belongs to the protein kinase superfamily. CAMK Ser/Thr protein kinase family.

Contains 1 protein kinase domain.

Sequence caution

The sequence AAH08344.1 differs from that shown. Reason: Erroneous initiation.

The sequence BAB15794.1 differs from that shown. Reason: Erroneous initiation.

The sequence BAC11361.1 differs from that shown. Reason: Erroneous initiation.

Alternative products

This entry describes 4 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q8N2I9-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q8N2I9-2)

The sequence of this isoform differs from the canonical sequence as follows:
     1-262: Missing.
     263-295: VLFTMLYGQFPFYDSIPQELFRKIKAAEYTIPE → MGLRQGNGTVSLGILATDPAPPTEPSSPTPCLR
Note: No experimental confirmation available.
Isoform 3 (identifier: Q8N2I9-3)

The sequence of this isoform differs from the canonical sequence as follows:
     364-417: AKVTEECSQY...PPVRRLGHDA → VSWGGQMGHY...GGKGRLQSSA
     418-435: Missing.
Note: No experimental confirmation available.
Isoform 4 (identifier: Q8N2I9-4)

The sequence of this isoform differs from the canonical sequence as follows:
     37-37: L → LALCAV
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 435435Serine/threonine-protein kinase 40
PRO_0000252261

Regions

Domain35 – 331297Protein kinase
Nucleotide binding41 – 499ATP By similarity

Sites

Active site1961Proton acceptor By similarity
Binding site661ATP By similarity

Natural variations

Alternative sequence1 – 262262Missing in isoform 2.
VSP_020896
Alternative sequence371L → LALCAV in isoform 4.
VSP_020897
Alternative sequence263 – 29533VLFTM…YTIPE → MGLRQGNGTVSLGILATDPA PPTEPSSPTPCLR in isoform 2.
VSP_020898
Alternative sequence364 – 41754AKVTE…LGHDA → VSWGGQMGHYPAPRDRLLGA GRARAEVAATRRPQSFLGLL PQPWGGKGRLQSSA in isoform 3.
VSP_020899
Alternative sequence418 – 43518Missing in isoform 3.
VSP_020900
Natural variant101A → V. Ref.9
Corresponds to variant rs56314546 [ dbSNP | Ensembl ].
VAR_041200
Natural variant1331M → T in a colorectal adenocarcinoma sample; somatic mutation. Ref.9
VAR_041201
Natural variant2111R → Q in a colorectal adenocarcinoma sample; somatic mutation. Ref.9
VAR_041202
Natural variant3951A → T. Ref.2 Ref.6 Ref.9
Corresponds to variant rs3795498 [ dbSNP | Ensembl ].
VAR_041203

Experimental info

Sequence conflict1911Missing in BAC11371. Ref.2
Sequence conflict3631E → Q in AAH05169. Ref.6

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified October 17, 2006. Version 2.
Checksum: EBA7A19963582BCC

FASTA43549,001
        10         20         30         40         50         60 
MKRRASDRGA GETSARAKAL GSGISGNNAK RAGPFILGPR LGNSPVPSIV QCLARKDGTD 

        70         80         90        100        110        120 
DFYQLKILTL EERGDQGIES QEERQGKMLL HTEYSLLSLL HTQDGVVHHH GLFQDRTCEI 

       130        140        150        160        170        180 
VEDTESSRMV KKMKKRICLV LDCLCAHDFS DKTADLINLQ HYVIKEKRLS ERETVVIFYD 

       190        200        210        220        230        240 
VVRVVEALHQ KNIVHRDLKL GNMVLNKRTH RITITNFCLG KHLVSEGDLL KDQRGSPAYI 

       250        260        270        280        290        300 
SPDVLSGRPY RGKPSDMWAL GVVLFTMLYG QFPFYDSIPQ ELFRKIKAAE YTIPEDGRVS 

       310        320        330        340        350        360 
ENTVCLIRKL LVLDPQQRLA AADVLEALSA IIASWQSLSS LSGPLQVVPD IDDQMSNADS 

       370        380        390        400        410        420 
SQEAKVTEEC SQYEFENYMR QQLLLAEEKS SIHDARSWVP KRQFGSAPPV RRLGHDAQPM 

       430 
TSLDTAILAQ RYLRK 

« Hide

Isoform 2 [UniParc].

Checksum: F219891A6F5C9AE1
Show »

FASTA17318,956
Isoform 3 [UniParc].

Checksum: 33C6B3B9131B8B77
Show »

FASTA41746,393
Isoform 4 [UniParc].

Checksum: 75428BCF0DE3717C
Show »

FASTA44049,459

References

« Hide 'large scale' references
[1]"Cloning and characterization of a novel Ser/Thr-like kinase."
Shan Y.X., Wu H., Yu L.
Submitted (DEC-2002) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
Tissue: Brain.
[2]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2 AND 3), VARIANT THR-395.
Tissue: Ovary, Spleen and Testis.
[3]"The full-ORF clone resource of the German cDNA consortium."
Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I.
BMC Genomics 8:399-399(2007) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Melanoma.
[4]"The DNA sequence and biological annotation of human chromosome 1."
Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K. expand/collapse author list , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[5]Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[6]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 4), VARIANT THR-395.
Tissue: Kidney and Muscle.
[7]"The protein kinase complement of the human genome."
Manning G., Whyte D.B., Martinez R., Hunter T., Sudarsanam S.
Science 298:1912-1934(2002) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION.
[8]"Identification of a novel serine/threonine kinase that inhibits TNF-induced NF-kappaB activation and p53-induced transcription."
Huang J., Teng L., Liu T., Li L., Chen D., Li F., Xu L.-G., Zhai Z., Shu H.-B.
Biochem. Biophys. Res. Commun. 309:774-778(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: FUNCTION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
[9]"Patterns of somatic mutation in human cancer genomes."
Greenman C., Stephens P., Smith R., Dalgliesh G.L., Hunter C., Bignell G., Davies H., Teague J., Butler A., Stevens C., Edkins S., O'Meara S., Vastrik I., Schmidt E.E., Avis T., Barthorpe S., Bhamra G., Buck G. expand/collapse author list , Choudhury B., Clements J., Cole J., Dicks E., Forbes S., Gray K., Halliday K., Harrison R., Hills K., Hinton J., Jenkinson A., Jones D., Menzies A., Mironenko T., Perry J., Raine K., Richardson D., Shepherd R., Small A., Tofts C., Varian J., Webb T., West S., Widaa S., Yates A., Cahill D.P., Louis D.N., Goldstraw P., Nicholson A.G., Brasseur F., Looijenga L., Weber B.L., Chiew Y.-E., DeFazio A., Greaves M.F., Green A.R., Campbell P., Birney E., Easton D.F., Chenevix-Trench G., Tan M.-H., Khoo S.K., Teh B.T., Yuen S.T., Leung S.Y., Wooster R., Futreal P.A., Stratton M.R.
Nature 446:153-158(2007) [PubMed] [Europe PMC] [Abstract]
Cited for: VARIANTS [LARGE SCALE ANALYSIS] VAL-10; THR-133; GLN-211 AND THR-395.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AY198395 mRNA. Translation: AAP20040.1.
AK024504 mRNA. Translation: BAB15794.1. Different initiation.
AK075029 mRNA. Translation: BAC11361.1. Different initiation.
AK075048 mRNA. Translation: BAC11371.1.
AK131560 mRNA. Translation: BAD18694.1.
AL834137 mRNA. Translation: CAD38852.1.
AL591845 Genomic DNA. Translation: CAH71862.1.
AL591845 Genomic DNA. Translation: CAH71863.1.
AL591845 Genomic DNA. Translation: CAH71864.1.
CH471059 Genomic DNA. Translation: EAX07371.1.
CH471059 Genomic DNA. Translation: EAX07373.1.
BC005169 mRNA. Translation: AAH05169.3.
BC007835 mRNA. Translation: AAH07835.2.
BC008344 mRNA. Translation: AAH08344.1. Different initiation.
CCDSCCDS407.1. [Q8N2I9-1]
CCDS60089.1. [Q8N2I9-4]
RefSeqNP_001269475.1. NM_001282546.1. [Q8N2I9-4]
NP_001269476.1. NM_001282547.1. [Q8N2I9-1]
NP_114406.1. NM_032017.2. [Q8N2I9-1]
UniGeneHs.471768.

3D structure databases

ProteinModelPortalQ8N2I9.
SMRQ8N2I9. Positions 35-369.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid123816. 4 interactions.
IntActQ8N2I9. 2 interactions.
MINTMINT-1382789.

Polymorphism databases

DMDM116256080.

Proteomic databases

MaxQBQ8N2I9.
PaxDbQ8N2I9.
PRIDEQ8N2I9.

Protocols and materials databases

DNASU83931.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000359297; ENSP00000352245; ENSG00000196182. [Q8N2I9-3]
ENST00000373129; ENSP00000362221; ENSG00000196182. [Q8N2I9-1]
ENST00000373130; ENSP00000362222; ENSG00000196182. [Q8N2I9-4]
ENST00000373132; ENSP00000362224; ENSG00000196182. [Q8N2I9-1]
GeneID83931.
KEGGhsa:83931.
UCSCuc001cak.1. human. [Q8N2I9-1]
uc001cal.1. human. [Q8N2I9-4]
uc001can.1. human. [Q8N2I9-3]

Organism-specific databases

CTD83931.
GeneCardsGC01M036805.
HGNCHGNC:21373. STK40.
HPAHPA008026.
MIM609437. gene.
neXtProtNX_Q8N2I9.
PharmGKBPA142670860.
GenAtlasSearch...

Phylogenomic databases

eggNOGCOG0515.
HOVERGENHBG080296.
KOK16312.
OMAGNIPPVR.
OrthoDBEOG7W1543.
PhylomeDBQ8N2I9.
TreeFamTF329785.

Enzyme and pathway databases

SignaLinkQ8N2I9.

Gene expression databases

BgeeQ8N2I9.
GenevestigatorQ8N2I9.

Family and domain databases

InterProIPR011009. Kinase-like_dom.
IPR000719. Prot_kinase_dom.
IPR024236. Ser/Thr_kinase_40.
IPR008271. Ser/Thr_kinase_AS.
IPR024104. Tribbles/Ser_Thr_kinase_40.
[Graphical view]
PANTHERPTHR22961. PTHR22961. 1 hit.
PTHR22961:SF1. PTHR22961:SF1. 1 hit.
PfamPF00069. Pkinase. 1 hit.
[Graphical view]
SUPFAMSSF56112. SSF56112. 1 hit.
PROSITEPS50011. PROTEIN_KINASE_DOM. 1 hit.
PS00108. PROTEIN_KINASE_ST. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

ChiTaRSSTK40. human.
GeneWikiSTK40.
GenomeRNAi83931.
NextBio73043.
PROQ8N2I9.
SOURCESearch...

Entry information

Entry nameSTK40_HUMAN
AccessionPrimary (citable) accession number: Q8N2I9
Secondary accession number(s): D3DPS8 expand/collapse secondary AC list , Q5VTK8, Q5VTK9, Q6ZMN1, Q8N2J8, Q8N3I6, Q96HN6, Q96I44, Q9BSA3, Q9H7H6
Entry history
Integrated into UniProtKB/Swiss-Prot: October 17, 2006
Last sequence update: October 17, 2006
Last modified: July 9, 2014
This is version 103 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

Human and mouse protein kinases

Human and mouse protein kinases: classification and index

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 1

Human chromosome 1: entries, gene names and cross-references to MIM