SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q8N2I9

- STK40_HUMAN

UniProt

Q8N2I9 - STK40_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Serine/threonine-protein kinase 40
Gene
STK40, SGK495, SHIK
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at transcript leveli

Functioni

May be a negative regulator of NF-kappa-B and p53-mediated gene transcription.1 Publication

Catalytic activityi

ATP + a protein = ADP + a phosphoprotein.

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Binding sitei66 – 661ATP By similarity
Active sitei196 – 1961Proton acceptor By similarity

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Nucleotide bindingi41 – 499ATP By similarity

GO - Molecular functioni

  1. ATP binding Source: UniProtKB-KW
  2. protein binding Source: UniProtKB
  3. protein serine/threonine kinase activity Source: UniProtKB-KW
Complete GO annotation...

Keywords - Molecular functioni

Kinase, Serine/threonine-protein kinase, Transferase

Keywords - Ligandi

ATP-binding, Nucleotide-binding

Enzyme and pathway databases

SignaLinkiQ8N2I9.

Names & Taxonomyi

Protein namesi
Recommended name:
Serine/threonine-protein kinase 40 (EC:2.7.11.1)
Alternative name(s):
SINK-homologous serine/threonine-protein kinase
Sugen kinase 495
Short name:
SgK495
Gene namesi
Name:STK40
Synonyms:SGK495, SHIK
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 1

Organism-specific databases

HGNCiHGNC:21373. STK40.

Subcellular locationi

Nucleus. Cytoplasm 1 Publication

GO - Cellular componenti

  1. cytoplasm Source: HPA
  2. nucleus Source: HPA
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA142670860.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 435435Serine/threonine-protein kinase 40
PRO_0000252261Add
BLAST

Proteomic databases

MaxQBiQ8N2I9.
PaxDbiQ8N2I9.
PRIDEiQ8N2I9.

Expressioni

Tissue specificityi

Strongly expressed in heart, brain, placenta, lung, skeletal muscle, kidney, spleen, thymus, prostate, liver, pancreas, testis, ovary, small intestine, colon and peripheral blood leukocytes.1 Publication

Gene expression databases

BgeeiQ8N2I9.
GenevestigatoriQ8N2I9.

Organism-specific databases

HPAiHPA008026.

Interactioni

Protein-protein interaction databases

BioGridi123816. 4 interactions.
IntActiQ8N2I9. 2 interactions.
MINTiMINT-1382789.

Structurei

3D structure databases

ProteinModelPortaliQ8N2I9.
SMRiQ8N2I9. Positions 35-369.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini35 – 331297Protein kinase
Add
BLAST

Sequence similaritiesi

Phylogenomic databases

eggNOGiCOG0515.
HOVERGENiHBG080296.
KOiK16312.
OMAiGNIPPVR.
OrthoDBiEOG7W1543.
PhylomeDBiQ8N2I9.
TreeFamiTF329785.

Family and domain databases

InterProiIPR011009. Kinase-like_dom.
IPR000719. Prot_kinase_dom.
IPR024236. Ser/Thr_kinase_40.
IPR008271. Ser/Thr_kinase_AS.
IPR024104. Tribbles/Ser_Thr_kinase_40.
[Graphical view]
PANTHERiPTHR22961. PTHR22961. 1 hit.
PTHR22961:SF1. PTHR22961:SF1. 1 hit.
PfamiPF00069. Pkinase. 1 hit.
[Graphical view]
SUPFAMiSSF56112. SSF56112. 1 hit.
PROSITEiPS50011. PROTEIN_KINASE_DOM. 1 hit.
PS00108. PROTEIN_KINASE_ST. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q8N2I9-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MKRRASDRGA GETSARAKAL GSGISGNNAK RAGPFILGPR LGNSPVPSIV    50
QCLARKDGTD DFYQLKILTL EERGDQGIES QEERQGKMLL HTEYSLLSLL 100
HTQDGVVHHH GLFQDRTCEI VEDTESSRMV KKMKKRICLV LDCLCAHDFS 150
DKTADLINLQ HYVIKEKRLS ERETVVIFYD VVRVVEALHQ KNIVHRDLKL 200
GNMVLNKRTH RITITNFCLG KHLVSEGDLL KDQRGSPAYI SPDVLSGRPY 250
RGKPSDMWAL GVVLFTMLYG QFPFYDSIPQ ELFRKIKAAE YTIPEDGRVS 300
ENTVCLIRKL LVLDPQQRLA AADVLEALSA IIASWQSLSS LSGPLQVVPD 350
IDDQMSNADS SQEAKVTEEC SQYEFENYMR QQLLLAEEKS SIHDARSWVP 400
KRQFGSAPPV RRLGHDAQPM TSLDTAILAQ RYLRK 435
Length:435
Mass (Da):49,001
Last modified:October 17, 2006 - v2
Checksum:iEBA7A19963582BCC
GO
Isoform 2 (identifier: Q8N2I9-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-262: Missing.
     263-295: VLFTMLYGQFPFYDSIPQELFRKIKAAEYTIPE → MGLRQGNGTVSLGILATDPAPPTEPSSPTPCLR

Note: No experimental confirmation available.

Show »
Length:173
Mass (Da):18,956
Checksum:iF219891A6F5C9AE1
GO
Isoform 3 (identifier: Q8N2I9-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     364-417: AKVTEECSQY...PPVRRLGHDA → VSWGGQMGHY...GGKGRLQSSA
     418-435: Missing.

Note: No experimental confirmation available.

Show »
Length:417
Mass (Da):46,393
Checksum:i33C6B3B9131B8B77
GO
Isoform 4 (identifier: Q8N2I9-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     37-37: L → LALCAV

Note: No experimental confirmation available.

Show »
Length:440
Mass (Da):49,459
Checksum:i75428BCF0DE3717C
GO

Sequence cautioni

The sequence AAH08344.1 differs from that shown. Reason: Erroneous initiation.
The sequence BAB15794.1 differs from that shown. Reason: Erroneous initiation.
The sequence BAC11361.1 differs from that shown. Reason: Erroneous initiation.

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti10 – 101A → V.1 Publication
Corresponds to variant rs56314546 [ dbSNP | Ensembl ].
VAR_041200
Natural varianti133 – 1331M → T in a colorectal adenocarcinoma sample; somatic mutation. 1 Publication
VAR_041201
Natural varianti211 – 2111R → Q in a colorectal adenocarcinoma sample; somatic mutation. 1 Publication
VAR_041202
Natural varianti395 – 3951A → T.3 Publications
Corresponds to variant rs3795498 [ dbSNP | Ensembl ].
VAR_041203

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 262262Missing in isoform 2.
VSP_020896Add
BLAST
Alternative sequencei37 – 371L → LALCAV in isoform 4.
VSP_020897
Alternative sequencei263 – 29533VLFTM…YTIPE → MGLRQGNGTVSLGILATDPA PPTEPSSPTPCLR in isoform 2.
VSP_020898Add
BLAST
Alternative sequencei364 – 41754AKVTE…LGHDA → VSWGGQMGHYPAPRDRLLGA GRARAEVAATRRPQSFLGLL PQPWGGKGRLQSSA in isoform 3.
VSP_020899Add
BLAST
Alternative sequencei418 – 43518Missing in isoform 3.
VSP_020900Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti191 – 1911Missing in BAC11371. 1 Publication
Sequence conflicti363 – 3631E → Q in AAH05169. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AY198395 mRNA. Translation: AAP20040.1.
AK024504 mRNA. Translation: BAB15794.1. Different initiation.
AK075029 mRNA. Translation: BAC11361.1. Different initiation.
AK075048 mRNA. Translation: BAC11371.1.
AK131560 mRNA. Translation: BAD18694.1.
AL834137 mRNA. Translation: CAD38852.1.
AL591845 Genomic DNA. Translation: CAH71862.1.
AL591845 Genomic DNA. Translation: CAH71863.1.
AL591845 Genomic DNA. Translation: CAH71864.1.
CH471059 Genomic DNA. Translation: EAX07371.1.
CH471059 Genomic DNA. Translation: EAX07373.1.
BC005169 mRNA. Translation: AAH05169.3.
BC007835 mRNA. Translation: AAH07835.2.
BC008344 mRNA. Translation: AAH08344.1. Different initiation.
CCDSiCCDS407.1. [Q8N2I9-1]
CCDS60089.1. [Q8N2I9-4]
RefSeqiNP_001269475.1. NM_001282546.1. [Q8N2I9-4]
NP_001269476.1. NM_001282547.1. [Q8N2I9-1]
NP_114406.1. NM_032017.2. [Q8N2I9-1]
UniGeneiHs.471768.

Genome annotation databases

EnsembliENST00000359297; ENSP00000352245; ENSG00000196182. [Q8N2I9-3]
ENST00000373129; ENSP00000362221; ENSG00000196182. [Q8N2I9-1]
ENST00000373130; ENSP00000362222; ENSG00000196182. [Q8N2I9-4]
ENST00000373132; ENSP00000362224; ENSG00000196182. [Q8N2I9-1]
GeneIDi83931.
KEGGihsa:83931.
UCSCiuc001cak.1. human. [Q8N2I9-1]
uc001cal.1. human. [Q8N2I9-4]
uc001can.1. human. [Q8N2I9-3]

Polymorphism databases

DMDMi116256080.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AY198395 mRNA. Translation: AAP20040.1 .
AK024504 mRNA. Translation: BAB15794.1 . Different initiation.
AK075029 mRNA. Translation: BAC11361.1 . Different initiation.
AK075048 mRNA. Translation: BAC11371.1 .
AK131560 mRNA. Translation: BAD18694.1 .
AL834137 mRNA. Translation: CAD38852.1 .
AL591845 Genomic DNA. Translation: CAH71862.1 .
AL591845 Genomic DNA. Translation: CAH71863.1 .
AL591845 Genomic DNA. Translation: CAH71864.1 .
CH471059 Genomic DNA. Translation: EAX07371.1 .
CH471059 Genomic DNA. Translation: EAX07373.1 .
BC005169 mRNA. Translation: AAH05169.3 .
BC007835 mRNA. Translation: AAH07835.2 .
BC008344 mRNA. Translation: AAH08344.1 . Different initiation.
CCDSi CCDS407.1. [Q8N2I9-1 ]
CCDS60089.1. [Q8N2I9-4 ]
RefSeqi NP_001269475.1. NM_001282546.1. [Q8N2I9-4 ]
NP_001269476.1. NM_001282547.1. [Q8N2I9-1 ]
NP_114406.1. NM_032017.2. [Q8N2I9-1 ]
UniGenei Hs.471768.

3D structure databases

ProteinModelPortali Q8N2I9.
SMRi Q8N2I9. Positions 35-369.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 123816. 4 interactions.
IntActi Q8N2I9. 2 interactions.
MINTi MINT-1382789.

Polymorphism databases

DMDMi 116256080.

Proteomic databases

MaxQBi Q8N2I9.
PaxDbi Q8N2I9.
PRIDEi Q8N2I9.

Protocols and materials databases

DNASUi 83931.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000359297 ; ENSP00000352245 ; ENSG00000196182 . [Q8N2I9-3 ]
ENST00000373129 ; ENSP00000362221 ; ENSG00000196182 . [Q8N2I9-1 ]
ENST00000373130 ; ENSP00000362222 ; ENSG00000196182 . [Q8N2I9-4 ]
ENST00000373132 ; ENSP00000362224 ; ENSG00000196182 . [Q8N2I9-1 ]
GeneIDi 83931.
KEGGi hsa:83931.
UCSCi uc001cak.1. human. [Q8N2I9-1 ]
uc001cal.1. human. [Q8N2I9-4 ]
uc001can.1. human. [Q8N2I9-3 ]

Organism-specific databases

CTDi 83931.
GeneCardsi GC01M036805.
HGNCi HGNC:21373. STK40.
HPAi HPA008026.
MIMi 609437. gene.
neXtProti NX_Q8N2I9.
PharmGKBi PA142670860.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG0515.
HOVERGENi HBG080296.
KOi K16312.
OMAi GNIPPVR.
OrthoDBi EOG7W1543.
PhylomeDBi Q8N2I9.
TreeFami TF329785.

Enzyme and pathway databases

SignaLinki Q8N2I9.

Miscellaneous databases

ChiTaRSi STK40. human.
GeneWikii STK40.
GenomeRNAii 83931.
NextBioi 73043.
PROi Q8N2I9.
SOURCEi Search...

Gene expression databases

Bgeei Q8N2I9.
Genevestigatori Q8N2I9.

Family and domain databases

InterProi IPR011009. Kinase-like_dom.
IPR000719. Prot_kinase_dom.
IPR024236. Ser/Thr_kinase_40.
IPR008271. Ser/Thr_kinase_AS.
IPR024104. Tribbles/Ser_Thr_kinase_40.
[Graphical view ]
PANTHERi PTHR22961. PTHR22961. 1 hit.
PTHR22961:SF1. PTHR22961:SF1. 1 hit.
Pfami PF00069. Pkinase. 1 hit.
[Graphical view ]
SUPFAMi SSF56112. SSF56112. 1 hit.
PROSITEi PS50011. PROTEIN_KINASE_DOM. 1 hit.
PS00108. PROTEIN_KINASE_ST. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Cloning and characterization of a novel Ser/Thr-like kinase."
    Shan Y.X., Wu H., Yu L.
    Submitted (DEC-2002) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Tissue: Brain.
  2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2 AND 3), VARIANT THR-395.
    Tissue: Ovary, Spleen and Testis.
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Melanoma.
  4. "The DNA sequence and biological annotation of human chromosome 1."
    Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K.
    , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
    Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 4), VARIANT THR-395.
    Tissue: Kidney and Muscle.
  7. Cited for: IDENTIFICATION.
  8. "Identification of a novel serine/threonine kinase that inhibits TNF-induced NF-kappaB activation and p53-induced transcription."
    Huang J., Teng L., Liu T., Li L., Chen D., Li F., Xu L.-G., Zhai Z., Shu H.-B.
    Biochem. Biophys. Res. Commun. 309:774-778(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
  9. "Patterns of somatic mutation in human cancer genomes."
    Greenman C., Stephens P., Smith R., Dalgliesh G.L., Hunter C., Bignell G., Davies H., Teague J., Butler A., Stevens C., Edkins S., O'Meara S., Vastrik I., Schmidt E.E., Avis T., Barthorpe S., Bhamra G., Buck G.
    , Choudhury B., Clements J., Cole J., Dicks E., Forbes S., Gray K., Halliday K., Harrison R., Hills K., Hinton J., Jenkinson A., Jones D., Menzies A., Mironenko T., Perry J., Raine K., Richardson D., Shepherd R., Small A., Tofts C., Varian J., Webb T., West S., Widaa S., Yates A., Cahill D.P., Louis D.N., Goldstraw P., Nicholson A.G., Brasseur F., Looijenga L., Weber B.L., Chiew Y.-E., DeFazio A., Greaves M.F., Green A.R., Campbell P., Birney E., Easton D.F., Chenevix-Trench G., Tan M.-H., Khoo S.K., Teh B.T., Yuen S.T., Leung S.Y., Wooster R., Futreal P.A., Stratton M.R.
    Nature 446:153-158(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: VARIANTS [LARGE SCALE ANALYSIS] VAL-10; THR-133; GLN-211 AND THR-395.

Entry informationi

Entry nameiSTK40_HUMAN
AccessioniPrimary (citable) accession number: Q8N2I9
Secondary accession number(s): D3DPS8
, Q5VTK8, Q5VTK9, Q6ZMN1, Q8N2J8, Q8N3I6, Q96HN6, Q96I44, Q9BSA3, Q9H7H6
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 17, 2006
Last sequence update: October 17, 2006
Last modified: July 9, 2014
This is version 103 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Human and mouse protein kinases
    Human and mouse protein kinases: classification and index
  6. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi