SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q8N264

- RHG24_HUMAN

UniProt

Q8N264 - RHG24_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Rho GTPase-activating protein 24

Gene
ARHGAP24, FILGAP
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Rho GTPase-activating protein involved in cell polarity, cell morphology and cytoskeletal organization. Acts as a GTPase activator for the Rac-type GTPase by converting it to an inactive GDP-bound state. Controls actin remodeling by inactivating Rac downstream of Rho leading to suppress leading edge protrusion and promotes cell retraction to achieve cellular polarity. Able to suppress RAC1 and CDC42 activity in vitro. Overexpression induces cell rounding with partial or complete disruption of actin stress fibers and formation of membrane ruffles, lamellipodia, and filopodia. Isoform 2 is a vascular cell-specific GAP involved in modulation of angiogenesis.3 Publications

GO - Molecular functioni

  1. protein binding Source: IntAct
  2. Rac GTPase activator activity Source: Ensembl

GO - Biological processi

  1. activation of Rac GTPase activity Source: Ensembl
  2. angiogenesis Source: UniProtKB-KW
  3. cell differentiation Source: UniProtKB-KW
  4. negative regulation of Rac protein signal transduction Source: Ensembl
  5. negative regulation of ruffle assembly Source: Ensembl
  6. regulation of small GTPase mediated signal transduction Source: Reactome
  7. small GTPase mediated signal transduction Source: Reactome
  8. wound healing, spreading of epidermal cells Source: Ensembl
Complete GO annotation...

Keywords - Molecular functioni

Developmental protein, GTPase activation

Keywords - Biological processi

Angiogenesis, Differentiation

Enzyme and pathway databases

ReactomeiREACT_11051. Rho GTPase cycle.

Names & Taxonomyi

Protein namesi
Recommended name:
Rho GTPase-activating protein 24
Alternative name(s):
Filamin-A-associated RhoGAP
Short name:
FilGAP
RAC1- and CDC42-specific GTPase-activating protein of 72 kDa
Short name:
RC-GAP72
Rho-type GTPase-activating protein 24
RhoGAP of 73 kDa
Sarcoma antigen NY-SAR-88
p73RhoGAP
Gene namesi
Synonyms:FILGAP
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 4

Organism-specific databases

HGNCiHGNC:25361. ARHGAP24.

Subcellular locationi

Cytoplasmcytoskeleton. Cell junctionadherens junction. Cell junctionfocal adhesion. Cell projection
Note: Localizes to actin stress fibers. In migrating cells, localizes to membrane lamellae and protusions.2 Publications

GO - Cellular componenti

  1. cell projection Source: UniProtKB-SubCell
  2. cytoskeleton Source: UniProtKB-SubCell
  3. cytosol Source: Reactome
  4. focal adhesion Source: UniProtKB-SubCell
Complete GO annotation...

Keywords - Cellular componenti

Cell junction, Cell projection, Cytoplasm, Cytoskeleton

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi175 – 1751R → A: Loss of function. 2 Publications
Mutagenesisi175 – 1751R → K: Does not abolish the effect on actin stress fibers but moderates its capability to induce membrane protrusions. 2 Publications

Organism-specific databases

Orphaneti93213. Familial idiopathic steroid-resistant nephrotic syndrome with focal segmental hyalinosis.
PharmGKBiPA134934054.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 748748Rho GTPase-activating protein 24PRO_0000280473Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei391 – 3911Phosphoserine1 Publication
Modified residuei402 – 4021Phosphoserine1 Publication
Modified residuei413 – 4131Phosphoserine1 Publication
Modified residuei415 – 4151Phosphoserine1 Publication
Modified residuei437 – 4371Phosphoserine1 Publication
Modified residuei452 – 4521Phosphothreonine1 Publication

Post-translational modificationi

Phosphorylated by ROCK, leading to activate the RacGAP activity.1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ8N264.
PaxDbiQ8N264.
PRIDEiQ8N264.

PTM databases

PhosphoSiteiQ8N264.

Expressioni

Tissue specificityi

Isoform 1 is widely expressed with a higher level in kidney. Isoform 2 is mainly expressed in endothelial cells.3 Publications

Inductioni

Isoform 2 is up-regulated during capillary tube formation in umbilical vein endothelial cells.1 Publication

Gene expression databases

ArrayExpressiQ8N264.
BgeeiQ8N264.
CleanExiHS_ARHGAP24.
GenevestigatoriQ8N264.

Organism-specific databases

HPAiHPA014288.

Interactioni

Subunit structurei

Interacts with FLNA.1 Publication

Binary interactionsi

WithEntry#Exp.IntActNotes
FLNAP213336EBI-988764,EBI-350432
HTTP428583EBI-988764,EBI-466029

Protein-protein interaction databases

BioGridi123663. 1 interaction.
DIPiDIP-35520N.
IntActiQ8N264. 4 interactions.
MINTiMINT-4725530.
STRINGi9606.ENSP00000315334.

Structurei

3D structure databases

ProteinModelPortaliQ8N264.
SMRiQ8N264. Positions 16-332.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini19 – 125107PHAdd
BLAST
Domaini135 – 329195Rho-GAPAdd
BLAST

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili649 – 72981 Reviewed predictionAdd
BLAST

Domaini

The coiled coil domain mediates the interaction with FLNA leading to its recruitment to lamellae.

Sequence similaritiesi

Contains 1 PH domain.
Contains 1 Rho-GAP domain.

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiNOG246008.
HOGENOMiHOG000232151.
HOVERGENiHBG058875.
InParanoidiQ8N264.
OMAiRYEKRYG.
OrthoDBiEOG79W94M.
PhylomeDBiQ8N264.
TreeFamiTF323577.

Family and domain databases

Gene3Di1.10.555.10. 1 hit.
2.30.29.30. 1 hit.
InterProiIPR001849. PH_domain.
IPR011993. PH_like_dom.
IPR008936. Rho_GTPase_activation_prot.
IPR000198. RhoGAP_dom.
[Graphical view]
PfamiPF00169. PH. 1 hit.
PF00620. RhoGAP. 1 hit.
[Graphical view]
SMARTiSM00233. PH. 1 hit.
SM00324. RhoGAP. 1 hit.
[Graphical view]
SUPFAMiSSF48350. SSF48350. 1 hit.
PROSITEiPS50003. PH_DOMAIN. 1 hit.
PS50238. RHOGAP. 1 hit.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q8N264-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MEENNDSTEN PQQGQGRQNA IKCGWLRKQG GFVKTWHTRW FVLKGDQLYY    50
FKDEDETKPL GTIFLPGNKV SEHPCNEENP GKFLFEVVPG GDRDRMTANH 100
ESYLLMASTQ NDMEDWVKSI RRVIWGPFGG GIFGQKLEDT VRYEKRYGNR 150
LAPMLVEQCV DFIRQRGLKE EGLFRLPGQA NLVKELQDAF DCGEKPSFDS 200
NTDVHTVASL LKLYLRELPE PVIPYAKYED FLSCAKLLSK EEEAGVKELA 250
KQVKSLPVVN YNLLKYICRF LDEVQSYSGV NKMSVQNLAT VFGPNILRPK 300
VEDPLTIMEG TVVVQQLMSV MISKHDCLFP KDAELQSKPQ DGVSNNNEIQ 350
KKATMGQLQN KENNNTKDSP SRQCSWDKSE SPQRSSMNNG SPTALSGSKT 400
NSPKNSVHKL DVSRSPPLMV KKNPAFNKGS GIVTNGSFSS SNAEGLEKTQ 450
TTPNGSLQAR RSSSLKVSGT KMGTHSVQNG TVRMGILNSD TLGNPTNVRN 500
MSWLPNGYVT LRDNKQKEQA GELGQHNRLS TYDNVHQQFS MMNLDDKQSI 550
DSATWSTSSC EISLPENSNS CRSSTTTCPE QDFFGGNFED PVLDGPPQDD 600
LSHPRDYESK SDHRSVGGRS SRATSSSDNS ETFVGNSSSN HSALHSLVSS 650
LKQEMTKQKI EYESRIKSLE QRNLTLETEM MSLHDELDQE RKKFTMIEIK 700
MRNAERAKED AEKRNDMLQK EMEQFFSTFG ELTVEPRRTE RGNTIWIQ 748
Length:748
Mass (Da):84,258
Last modified:March 20, 2007 - v2
Checksum:i87A8E6DCA6869229
GO
Isoform 2 (identifier: Q8N264-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-93: Missing.
     94-130: DRMTANHESYLLMASTQNDMEDWVKSIRRVIWGPFGG → MPEDRNSGGCPAGALASTPFIPKTTYRRIKRCFSFRK

Show »
Length:655
Mass (Da):73,409
Checksum:i1497D420E9DD3FE5
GO
Isoform 3 (identifier: Q8N264-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-95: Missing.

Show »
Length:653
Mass (Da):73,290
Checksum:iF6A68FEF1E0A5564
GO
Isoform 4 (identifier: Q8N264-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     245-246: GV → VS
     247-748: Missing.

Note: No experimental confirmation available.

Show »
Length:246
Mass (Da):28,249
Checksum:i9AC9E1CA3D589430
GO
Isoform 5 (identifier: Q8N264-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MWLRKKDWQI...QQGKSISLIM
     91-94: GDRD → KIFS
     95-748: Missing.

Note: No experimental confirmation available.

Show »
Length:239
Mass (Da):28,221
Checksum:i44E3F4574FA33D77
GO

Sequence cautioni

The sequence AAO65178.1 differs from that shown. Reason: Frameshift at several positions.

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 9595Missing in isoform 3. VSP_023711Add
BLAST
Alternative sequencei1 – 9393Missing in isoform 2. VSP_023712Add
BLAST
Alternative sequencei1 – 11M → MWLRKKDWQIFNEQFLKKEH AVGFCFSKCVLVEFSLKCFK KIKSSYWNNDALAFLGKKFL REKNKMTKKQTRNRQNKFPP KPALRSSPVHRVQHFPLLWK VKEPHYHLFFFAFSYCWSWE PFPSEQQPCPASVLSSQQGK SISLIM in isoform 5. VSP_023713
Alternative sequencei91 – 944GDRD → KIFS in isoform 5. VSP_023714
Alternative sequencei94 – 13037DRMTA…GPFGG → MPEDRNSGGCPAGALASTPF IPKTTYRRIKRCFSFRK in isoform 2. VSP_023715Add
BLAST
Alternative sequencei95 – 748654Missing in isoform 5. VSP_023716Add
BLAST
Alternative sequencei245 – 2462GV → VS in isoform 4. VSP_023717
Alternative sequencei247 – 748502Missing in isoform 4. VSP_023718Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti140 – 1401T → A in BAC03606. 1 Publication
Sequence conflicti357 – 3571Q → L in CAB66581. 1 Publication
Sequence conflicti722 – 7221M → V in BAC03606. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AL136646 mRNA. Translation: CAB66581.1.
AK091196 mRNA. Translation: BAC03606.1.
AK130576 mRNA. Translation: BAC85384.1.
BC047918 mRNA. Translation: AAH47918.1.
BC098580 mRNA. Translation: AAH98580.1.
AY211925 mRNA. Translation: AAO65178.1. Frameshift.
CCDSiCCDS34025.1. [Q8N264-1]
CCDS3611.1. [Q8N264-2]
CCDS43246.1. [Q8N264-3]
PIRiA59430.
RefSeqiNP_001020787.2. NM_001025616.2. [Q8N264-1]
NP_001036134.1. NM_001042669.1. [Q8N264-3]
NP_112595.2. NM_031305.2. [Q8N264-2]
XP_005263320.1. XM_005263263.2. [Q8N264-1]
UniGeneiHs.444229.

Genome annotation databases

EnsembliENST00000264343; ENSP00000264343; ENSG00000138639. [Q8N264-2]
ENST00000395183; ENSP00000378610; ENSG00000138639. [Q8N264-3]
ENST00000395184; ENSP00000378611; ENSG00000138639. [Q8N264-1]
ENST00000503995; ENSP00000423206; ENSG00000138639. [Q8N264-4]
GeneIDi83478.
KEGGihsa:83478.
UCSCiuc003hpj.3. human. [Q8N264-4]
uc003hpk.3. human. [Q8N264-1]
uc003hpm.3. human. [Q8N264-2]
uc010ikf.3. human. [Q8N264-3]

Polymorphism databases

DMDMi134035016.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AL136646 mRNA. Translation: CAB66581.1 .
AK091196 mRNA. Translation: BAC03606.1 .
AK130576 mRNA. Translation: BAC85384.1 .
BC047918 mRNA. Translation: AAH47918.1 .
BC098580 mRNA. Translation: AAH98580.1 .
AY211925 mRNA. Translation: AAO65178.1 . Frameshift.
CCDSi CCDS34025.1. [Q8N264-1 ]
CCDS3611.1. [Q8N264-2 ]
CCDS43246.1. [Q8N264-3 ]
PIRi A59430.
RefSeqi NP_001020787.2. NM_001025616.2. [Q8N264-1 ]
NP_001036134.1. NM_001042669.1. [Q8N264-3 ]
NP_112595.2. NM_031305.2. [Q8N264-2 ]
XP_005263320.1. XM_005263263.2. [Q8N264-1 ]
UniGenei Hs.444229.

3D structure databases

ProteinModelPortali Q8N264.
SMRi Q8N264. Positions 16-332.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 123663. 1 interaction.
DIPi DIP-35520N.
IntActi Q8N264. 4 interactions.
MINTi MINT-4725530.
STRINGi 9606.ENSP00000315334.

PTM databases

PhosphoSitei Q8N264.

Polymorphism databases

DMDMi 134035016.

Proteomic databases

MaxQBi Q8N264.
PaxDbi Q8N264.
PRIDEi Q8N264.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000264343 ; ENSP00000264343 ; ENSG00000138639 . [Q8N264-2 ]
ENST00000395183 ; ENSP00000378610 ; ENSG00000138639 . [Q8N264-3 ]
ENST00000395184 ; ENSP00000378611 ; ENSG00000138639 . [Q8N264-1 ]
ENST00000503995 ; ENSP00000423206 ; ENSG00000138639 . [Q8N264-4 ]
GeneIDi 83478.
KEGGi hsa:83478.
UCSCi uc003hpj.3. human. [Q8N264-4 ]
uc003hpk.3. human. [Q8N264-1 ]
uc003hpm.3. human. [Q8N264-2 ]
uc010ikf.3. human. [Q8N264-3 ]

Organism-specific databases

CTDi 83478.
GeneCardsi GC04P086396.
H-InvDB HIX0004350.
HGNCi HGNC:25361. ARHGAP24.
HPAi HPA014288.
MIMi 610586. gene.
neXtProti NX_Q8N264.
Orphaneti 93213. Familial idiopathic steroid-resistant nephrotic syndrome with focal segmental hyalinosis.
PharmGKBi PA134934054.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG246008.
HOGENOMi HOG000232151.
HOVERGENi HBG058875.
InParanoidi Q8N264.
OMAi RYEKRYG.
OrthoDBi EOG79W94M.
PhylomeDBi Q8N264.
TreeFami TF323577.

Enzyme and pathway databases

Reactomei REACT_11051. Rho GTPase cycle.

Miscellaneous databases

ChiTaRSi ARHGAP24. human.
GeneWikii ARHGAP24.
GenomeRNAii 83478.
NextBioi 72411.
PROi Q8N264.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q8N264.
Bgeei Q8N264.
CleanExi HS_ARHGAP24.
Genevestigatori Q8N264.

Family and domain databases

Gene3Di 1.10.555.10. 1 hit.
2.30.29.30. 1 hit.
InterProi IPR001849. PH_domain.
IPR011993. PH_like_dom.
IPR008936. Rho_GTPase_activation_prot.
IPR000198. RhoGAP_dom.
[Graphical view ]
Pfami PF00169. PH. 1 hit.
PF00620. RhoGAP. 1 hit.
[Graphical view ]
SMARTi SM00233. PH. 1 hit.
SM00324. RhoGAP. 1 hit.
[Graphical view ]
SUPFAMi SSF48350. SSF48350. 1 hit.
PROSITEi PS50003. PH_DOMAIN. 1 hit.
PS50238. RHOGAP. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Brain.
  2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 5).
    Tissue: Spleen and Tongue.
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3 AND 4).
    Tissue: Chondrosarcoma.
  4. Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 233-510.
  5. "Identification and characterization of ARHGAP24 and ARHGAP25 genes in silico."
    Katoh M., Katoh M.
    Int. J. Mol. Med. 14:333-338(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION.
  6. Cited for: FUNCTION, TISSUE SPECIFICITY, INDUCTION, MUTAGENESIS OF ARG-175.
  7. "Characterization of a novel GTPase-activating protein associated with focal adhesions and the actin cytoskeleton."
    Lavelin I., Geiger B.
    J. Biol. Chem. 280:7178-7185(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY, MUTAGENESIS OF ARG-175.
  8. "FilGAP, a Rho- and ROCK-regulated GAP for Rac binds filamin A to control actin remodelling."
    Ohta Y., Hartwig J.H., Stossel T.P.
    Nat. Cell Biol. 8:803-814(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY, INTERACTION WITH FLNA, PHOSPHORYLATION AT SER-391; SER-402; SER-413; SER-415; SER-437 AND THR-452.

Entry informationi

Entry nameiRHG24_HUMAN
AccessioniPrimary (citable) accession number: Q8N264
Secondary accession number(s): Q4KMG1
, Q6ZNV3, Q86TI5, Q86WE4, Q9H0T6
Entry historyi
Integrated into UniProtKB/Swiss-Prot: March 20, 2007
Last sequence update: March 20, 2007
Last modified: September 3, 2014
This is version 103 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 4
    Human chromosome 4: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi