Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Rho GTPase-activating protein 24

Gene

ARHGAP24

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Rho GTPase-activating protein involved in cell polarity, cell morphology and cytoskeletal organization. Acts as a GTPase activator for the Rac-type GTPase by converting it to an inactive GDP-bound state. Controls actin remodeling by inactivating Rac downstream of Rho leading to suppress leading edge protrusion and promotes cell retraction to achieve cellular polarity. Able to suppress RAC1 and CDC42 activity in vitro. Overexpression induces cell rounding with partial or complete disruption of actin stress fibers and formation of membrane ruffles, lamellipodia, and filopodia. Isoform 2 is a vascular cell-specific GAP involved in modulation of angiogenesis.3 Publications

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Developmental protein, GTPase activation

Keywords - Biological processi

Angiogenesis, Differentiation

Enzyme and pathway databases

BioCyciZFISH:ENSG00000138639-MONOMER.
ReactomeiR-HSA-194840. Rho GTPase cycle.
SIGNORiQ8N264.

Names & Taxonomyi

Protein namesi
Recommended name:
Rho GTPase-activating protein 24
Alternative name(s):
Filamin-A-associated RhoGAP
Short name:
FilGAP
RAC1- and CDC42-specific GTPase-activating protein of 72 kDa
Short name:
RC-GAP72
Rho-type GTPase-activating protein 24
RhoGAP of 73 kDa
Sarcoma antigen NY-SAR-88
p73RhoGAP
Gene namesi
Name:ARHGAP24
Synonyms:FILGAP
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 4

Organism-specific databases

HGNCiHGNC:25361. ARHGAP24.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cell junction, Cell projection, Cytoplasm, Cytoskeleton

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi175R → A: Loss of function. 2 Publications1
Mutagenesisi175R → K: Does not abolish the effect on actin stress fibers but moderates its capability to induce membrane protrusions. 2 Publications1

Organism-specific databases

DisGeNETi83478.
MalaCardsiARHGAP24.
OpenTargetsiENSG00000138639.
Orphaneti93213. Familial idiopathic steroid-resistant nephrotic syndrome with focal segmental hyalinosis.
PharmGKBiPA134934054.

Polymorphism and mutation databases

BioMutaiARHGAP24.
DMDMi134035016.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002804731 – 748Rho GTPase-activating protein 24Add BLAST748

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei369PhosphoserineBy similarity1
Modified residuei391Phosphoserine1 Publication1
Modified residuei396PhosphoserineBy similarity1
Modified residuei398PhosphoserineBy similarity1
Modified residuei402Phosphoserine1 Publication1
Modified residuei413Phosphoserine1 Publication1
Modified residuei415PhosphoserineCombined sources1 Publication1
Modified residuei437Phosphoserine1 Publication1
Modified residuei452Phosphothreonine1 Publication1

Post-translational modificationi

Phosphorylated by ROCK, leading to activate the RacGAP activity.1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ8N264.
PaxDbiQ8N264.
PeptideAtlasiQ8N264.
PRIDEiQ8N264.

PTM databases

iPTMnetiQ8N264.
PhosphoSitePlusiQ8N264.

Expressioni

Tissue specificityi

Isoform 1 is widely expressed with a higher level in kidney. Isoform 2 is mainly expressed in endothelial cells.3 Publications

Inductioni

Isoform 2 is up-regulated during capillary tube formation in umbilical vein endothelial cells.1 Publication

Gene expression databases

BgeeiENSG00000138639.
CleanExiHS_ARHGAP24.
ExpressionAtlasiQ8N264. baseline and differential.
GenevisibleiQ8N264. HS.

Organism-specific databases

HPAiHPA014288.

Interactioni

Subunit structurei

Interacts with FLNA.1 Publication

Binary interactionsi

WithEntry#Exp.IntActNotes
FLNAP213336EBI-988764,EBI-350432
HTTP428583EBI-988764,EBI-466029

Protein-protein interaction databases

BioGridi123663. 1 interactor.
DIPiDIP-35520N.
IntActiQ8N264. 4 interactors.
MINTiMINT-4725530.
STRINGi9606.ENSP00000378611.

Structurei

3D structure databases

ProteinModelPortaliQ8N264.
SMRiQ8N264.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini19 – 125PHPROSITE-ProRule annotationAdd BLAST107
Domaini135 – 329Rho-GAPPROSITE-ProRule annotationAdd BLAST195

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili649 – 729Sequence analysisAdd BLAST81

Domaini

The coiled coil domain mediates the interaction with FLNA leading to its recruitment to lamellae.

Sequence similaritiesi

Contains 1 PH domain.PROSITE-ProRule annotation
Contains 1 Rho-GAP domain.PROSITE-ProRule annotation

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiKOG4270. Eukaryota.
ENOG410XRR2. LUCA.
GeneTreeiENSGT00760000118863.
HOGENOMiHOG000232151.
HOVERGENiHBG058875.
InParanoidiQ8N264.
KOiK20642.
OMAiSHENRMN.
OrthoDBiEOG091G02DD.
PhylomeDBiQ8N264.
TreeFamiTF323577.

Family and domain databases

Gene3Di1.10.555.10. 1 hit.
2.30.29.30. 1 hit.
InterProiIPR011993. PH_dom-like.
IPR001849. PH_domain.
IPR008936. Rho_GTPase_activation_prot.
IPR000198. RhoGAP_dom.
[Graphical view]
PfamiPF00169. PH. 1 hit.
PF00620. RhoGAP. 1 hit.
[Graphical view]
SMARTiSM00233. PH. 1 hit.
SM00324. RhoGAP. 1 hit.
[Graphical view]
SUPFAMiSSF48350. SSF48350. 1 hit.
SSF50729. SSF50729. 1 hit.
PROSITEiPS50003. PH_DOMAIN. 1 hit.
PS50238. RHOGAP. 1 hit.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8N264-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MEENNDSTEN PQQGQGRQNA IKCGWLRKQG GFVKTWHTRW FVLKGDQLYY
60 70 80 90 100
FKDEDETKPL GTIFLPGNKV SEHPCNEENP GKFLFEVVPG GDRDRMTANH
110 120 130 140 150
ESYLLMASTQ NDMEDWVKSI RRVIWGPFGG GIFGQKLEDT VRYEKRYGNR
160 170 180 190 200
LAPMLVEQCV DFIRQRGLKE EGLFRLPGQA NLVKELQDAF DCGEKPSFDS
210 220 230 240 250
NTDVHTVASL LKLYLRELPE PVIPYAKYED FLSCAKLLSK EEEAGVKELA
260 270 280 290 300
KQVKSLPVVN YNLLKYICRF LDEVQSYSGV NKMSVQNLAT VFGPNILRPK
310 320 330 340 350
VEDPLTIMEG TVVVQQLMSV MISKHDCLFP KDAELQSKPQ DGVSNNNEIQ
360 370 380 390 400
KKATMGQLQN KENNNTKDSP SRQCSWDKSE SPQRSSMNNG SPTALSGSKT
410 420 430 440 450
NSPKNSVHKL DVSRSPPLMV KKNPAFNKGS GIVTNGSFSS SNAEGLEKTQ
460 470 480 490 500
TTPNGSLQAR RSSSLKVSGT KMGTHSVQNG TVRMGILNSD TLGNPTNVRN
510 520 530 540 550
MSWLPNGYVT LRDNKQKEQA GELGQHNRLS TYDNVHQQFS MMNLDDKQSI
560 570 580 590 600
DSATWSTSSC EISLPENSNS CRSSTTTCPE QDFFGGNFED PVLDGPPQDD
610 620 630 640 650
LSHPRDYESK SDHRSVGGRS SRATSSSDNS ETFVGNSSSN HSALHSLVSS
660 670 680 690 700
LKQEMTKQKI EYESRIKSLE QRNLTLETEM MSLHDELDQE RKKFTMIEIK
710 720 730 740
MRNAERAKED AEKRNDMLQK EMEQFFSTFG ELTVEPRRTE RGNTIWIQ
Length:748
Mass (Da):84,258
Last modified:March 20, 2007 - v2
Checksum:i87A8E6DCA6869229
GO
Isoform 2 (identifier: Q8N264-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-93: Missing.
     94-130: DRMTANHESYLLMASTQNDMEDWVKSIRRVIWGPFGG → MPEDRNSGGCPAGALASTPFIPKTTYRRIKRCFSFRK

Show »
Length:655
Mass (Da):73,409
Checksum:i1497D420E9DD3FE5
GO
Isoform 3 (identifier: Q8N264-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-95: Missing.

Show »
Length:653
Mass (Da):73,290
Checksum:iF6A68FEF1E0A5564
GO
Isoform 4 (identifier: Q8N264-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     245-246: GV → VS
     247-748: Missing.

Note: No experimental confirmation available.
Show »
Length:246
Mass (Da):28,249
Checksum:i9AC9E1CA3D589430
GO
Isoform 5 (identifier: Q8N264-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MWLRKKDWQI...QQGKSISLIM
     91-94: GDRD → KIFS
     95-748: Missing.

Note: No experimental confirmation available.
Show »
Length:239
Mass (Da):28,221
Checksum:i44E3F4574FA33D77
GO

Sequence cautioni

The sequence AAO65178 differs from that shown. Reason: Frameshift at several positions.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti140T → A in BAC03606 (PubMed:14702039).Curated1
Sequence conflicti357Q → L in CAB66581 (PubMed:11230166).Curated1
Sequence conflicti722M → V in BAC03606 (PubMed:14702039).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0237111 – 95Missing in isoform 3. 1 PublicationAdd BLAST95
Alternative sequenceiVSP_0237121 – 93Missing in isoform 2. 1 PublicationAdd BLAST93
Alternative sequenceiVSP_0237131M → MWLRKKDWQIFNEQFLKKEH AVGFCFSKCVLVEFSLKCFK KIKSSYWNNDALAFLGKKFL REKNKMTKKQTRNRQNKFPP KPALRSSPVHRVQHFPLLWK VKEPHYHLFFFAFSYCWSWE PFPSEQQPCPASVLSSQQGK SISLIM in isoform 5. 1 Publication1
Alternative sequenceiVSP_02371491 – 94GDRD → KIFS in isoform 5. 1 Publication4
Alternative sequenceiVSP_02371594 – 130DRMTA…GPFGG → MPEDRNSGGCPAGALASTPF IPKTTYRRIKRCFSFRK in isoform 2. 1 PublicationAdd BLAST37
Alternative sequenceiVSP_02371695 – 748Missing in isoform 5. 1 PublicationAdd BLAST654
Alternative sequenceiVSP_023717245 – 246GV → VS in isoform 4. 1 Publication2
Alternative sequenceiVSP_023718247 – 748Missing in isoform 4. 1 PublicationAdd BLAST502

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AL136646 mRNA. Translation: CAB66581.1.
AK091196 mRNA. Translation: BAC03606.1.
AK130576 mRNA. Translation: BAC85384.1.
BC047918 mRNA. Translation: AAH47918.1.
BC098580 mRNA. Translation: AAH98580.1.
AY211925 mRNA. Translation: AAO65178.1. Frameshift.
CCDSiCCDS34025.1. [Q8N264-1]
CCDS3611.1. [Q8N264-2]
CCDS43246.1. [Q8N264-3]
PIRiA59430.
RefSeqiNP_001020787.2. NM_001025616.2. [Q8N264-1]
NP_001036134.1. NM_001042669.1. [Q8N264-3]
NP_112595.2. NM_031305.2. [Q8N264-2]
XP_011530602.1. XM_011532300.2. [Q8N264-3]
UniGeneiHs.444229.
Hs.689398.

Genome annotation databases

EnsembliENST00000264343; ENSP00000264343; ENSG00000138639. [Q8N264-2]
ENST00000395183; ENSP00000378610; ENSG00000138639. [Q8N264-3]
ENST00000395184; ENSP00000378611; ENSG00000138639. [Q8N264-1]
ENST00000503995; ENSP00000423206; ENSG00000138639. [Q8N264-4]
GeneIDi83478.
KEGGihsa:83478.
UCSCiuc003hpj.4. human. [Q8N264-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AL136646 mRNA. Translation: CAB66581.1.
AK091196 mRNA. Translation: BAC03606.1.
AK130576 mRNA. Translation: BAC85384.1.
BC047918 mRNA. Translation: AAH47918.1.
BC098580 mRNA. Translation: AAH98580.1.
AY211925 mRNA. Translation: AAO65178.1. Frameshift.
CCDSiCCDS34025.1. [Q8N264-1]
CCDS3611.1. [Q8N264-2]
CCDS43246.1. [Q8N264-3]
PIRiA59430.
RefSeqiNP_001020787.2. NM_001025616.2. [Q8N264-1]
NP_001036134.1. NM_001042669.1. [Q8N264-3]
NP_112595.2. NM_031305.2. [Q8N264-2]
XP_011530602.1. XM_011532300.2. [Q8N264-3]
UniGeneiHs.444229.
Hs.689398.

3D structure databases

ProteinModelPortaliQ8N264.
SMRiQ8N264.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi123663. 1 interactor.
DIPiDIP-35520N.
IntActiQ8N264. 4 interactors.
MINTiMINT-4725530.
STRINGi9606.ENSP00000378611.

PTM databases

iPTMnetiQ8N264.
PhosphoSitePlusiQ8N264.

Polymorphism and mutation databases

BioMutaiARHGAP24.
DMDMi134035016.

Proteomic databases

MaxQBiQ8N264.
PaxDbiQ8N264.
PeptideAtlasiQ8N264.
PRIDEiQ8N264.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000264343; ENSP00000264343; ENSG00000138639. [Q8N264-2]
ENST00000395183; ENSP00000378610; ENSG00000138639. [Q8N264-3]
ENST00000395184; ENSP00000378611; ENSG00000138639. [Q8N264-1]
ENST00000503995; ENSP00000423206; ENSG00000138639. [Q8N264-4]
GeneIDi83478.
KEGGihsa:83478.
UCSCiuc003hpj.4. human. [Q8N264-1]

Organism-specific databases

CTDi83478.
DisGeNETi83478.
GeneCardsiARHGAP24.
H-InvDBHIX0004350.
HGNCiHGNC:25361. ARHGAP24.
HPAiHPA014288.
MalaCardsiARHGAP24.
MIMi610586. gene.
neXtProtiNX_Q8N264.
OpenTargetsiENSG00000138639.
Orphaneti93213. Familial idiopathic steroid-resistant nephrotic syndrome with focal segmental hyalinosis.
PharmGKBiPA134934054.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG4270. Eukaryota.
ENOG410XRR2. LUCA.
GeneTreeiENSGT00760000118863.
HOGENOMiHOG000232151.
HOVERGENiHBG058875.
InParanoidiQ8N264.
KOiK20642.
OMAiSHENRMN.
OrthoDBiEOG091G02DD.
PhylomeDBiQ8N264.
TreeFamiTF323577.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000138639-MONOMER.
ReactomeiR-HSA-194840. Rho GTPase cycle.
SIGNORiQ8N264.

Miscellaneous databases

ChiTaRSiARHGAP24. human.
GeneWikiiARHGAP24.
GenomeRNAii83478.
PROiQ8N264.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000138639.
CleanExiHS_ARHGAP24.
ExpressionAtlasiQ8N264. baseline and differential.
GenevisibleiQ8N264. HS.

Family and domain databases

Gene3Di1.10.555.10. 1 hit.
2.30.29.30. 1 hit.
InterProiIPR011993. PH_dom-like.
IPR001849. PH_domain.
IPR008936. Rho_GTPase_activation_prot.
IPR000198. RhoGAP_dom.
[Graphical view]
PfamiPF00169. PH. 1 hit.
PF00620. RhoGAP. 1 hit.
[Graphical view]
SMARTiSM00233. PH. 1 hit.
SM00324. RhoGAP. 1 hit.
[Graphical view]
SUPFAMiSSF48350. SSF48350. 1 hit.
SSF50729. SSF50729. 1 hit.
PROSITEiPS50003. PH_DOMAIN. 1 hit.
PS50238. RHOGAP. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiRHG24_HUMAN
AccessioniPrimary (citable) accession number: Q8N264
Secondary accession number(s): Q4KMG1
, Q6ZNV3, Q86TI5, Q86WE4, Q9H0T6
Entry historyi
Integrated into UniProtKB/Swiss-Prot: March 20, 2007
Last sequence update: March 20, 2007
Last modified: November 2, 2016
This is version 121 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 4
    Human chromosome 4: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.