Reviewed,
UniProtKB/Swiss-Prot Q8N264 (RHG24_HUMAN)
Last modified
November 24, 2009.
Version 61.
History...
Clusters with 100%,
90%,
50% identity |
Documents (3) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Rho GTPase-activating protein 24 Alternative name(s): Rho-type GTPase-activating protein 24 Filamin-A-associated RhoGAP Short name=FilGAP RhoGAP of 73 kDa p73RhoGAP RAC1- and CDC42-specific GTPase-activating protein of 72 kDa Short name=RC-GAP72 Sarcoma antigen NY-SAR-88 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Complete proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 748 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | Rho GTPase-activating protein involved in cell polarity, cell morphology and cytoskeletal organization. Acts as a GTPase activator for the Rac-type GTPase by converting it to an inactive GDP-bound state. Controls actin remodeling by inactivating Rac downstream of Rho leading to suppress leading edge protrusion and promotes cell retraction to achieve cellular polarity. Able to suppress RAC1 and CDC42 activity in vitro. Overexpression induces cell rounding with partial or complete disruption of actin stress fibers and formation of membrane ruffles, lamellipodia, and filopodia. Isoform 2 is a vascular cell-specific GAP involved in modulation of angiogenesis. Ref.6 Ref.7 Ref.8 |
| Subunit structure | Interacts with FLNA. Ref.8 |
| Subcellular location | Cytoplasm › cytoskeleton. Cell junction › adherens junction. Cell junction › focal adhesion. Cell projection. Note: Localizes to actin stress fibers. In migrating cells, localizes to membrane lamellae and protusions. Ref.7 Ref.8 |
| Tissue specificity | Isoform 1 is widely expressed with a higher level in kidney. Isoform 2 is mainly expressed in endothelial cells. Ref.6 Ref.7 Ref.8 |
| Induction | Isoform 2 is up-regulated during capillary tube formation in umbilical vein endothelial cells. Ref.6 |
| Domain | The coiled coil domain mediates the interaction with FLNA leading to its recruitment to lamellae. |
| Post-translational modification | Phosphorylated by ROCK, leading to activate the RacGAP activity. Ref.8 |
| Sequence similarities | Contains 1 PH domain. Contains 1 Rho-GAP domain. |
| Sequence caution | The sequence AAO65178.1 differs from that shown. Reason: Frameshift at several positions. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| FLNA | P21333 | 3 | EBI-988764,EBI-350432 | |
| Rock1 | P70335 | 1 | EBI-988764,EBI-989293 | From a different organism. |
Alternative products
| This entry describes 5 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q8N264-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q8N264-2) The sequence of this isoform differs from the canonical sequence as follows: 1-93: Missing. 94-130: DRMTANHESYLLMASTQNDMEDWVKSIRRVIWGPFGG → MPEDRNSGGCPAGALASTPFIPKTTYRRIKRCFSFRK | ||||||
| Isoform 3 (identifier: Q8N264-3) The sequence of this isoform differs from the canonical sequence as follows: 1-95: Missing. | ||||||
| Isoform 4 (identifier: Q8N264-4) The sequence of this isoform differs from the canonical sequence as follows: 245-246: GV → VS 247-748: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 5 (identifier: Q8N264-5) The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MWLRKKDWQI...QQGKSISLIM 91-94: GDRD → KIFS 95-748: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 748 | 748 | Rho GTPase-activating protein 24 | PRO_0000280473 | |||||
Regions | |||||||||
| Domain | 19 – 125 | 107 | PH | ||||||
| Domain | 135 – 329 | 195 | Rho-GAP | ||||||
| Coiled coil | 649 – 729 | 81 | Potential | ||||||
Amino acid modifications | |||||||||
| Modified residue | 391 | 1 | Phosphoserine Ref.8 | ||||||
| Modified residue | 402 | 1 | Phosphoserine Ref.8 | ||||||
| Modified residue | 413 | 1 | Phosphoserine Ref.8 | ||||||
| Modified residue | 415 | 1 | Phosphoserine Ref.8 | ||||||
| Modified residue | 437 | 1 | Phosphoserine Ref.8 | ||||||
| Modified residue | 452 | 1 | Phosphothreonine Ref.8 | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 95 | 95 | Missing in isoform 3. | VSP_023711 | |||||
| Alternative sequence | 1 – 93 | 93 | Missing in isoform 2. | VSP_023712 | |||||
| Alternative sequence | 1 | 1 | M → MWLRKKDWQIFNEQFLKKEH AVGFCFSKCVLVEFSLKCFK KIKSSYWNNDALAFLGKKFL REKNKMTKKQTRNRQNKFPP KPALRSSPVHRVQHFPLLWK VKEPHYHLFFFAFSYCWSWE PFPSEQQPCPASVLSSQQGK SISLIM in isoform 5. | VSP_023713 | |||||
| Alternative sequence | 91 – 94 | 4 | GDRD → KIFS in isoform 5. | VSP_023714 | |||||
| Alternative sequence | 94 – 130 | 37 | DRMTA…GPFGG → MPEDRNSGGCPAGALASTPF IPKTTYRRIKRCFSFRK in isoform 2. | VSP_023715 | |||||
| Alternative sequence | 95 – 748 | 654 | Missing in isoform 5. | VSP_023716 | |||||
| Alternative sequence | 245 – 246 | 2 | GV → VS in isoform 4. | VSP_023717 | |||||
| Alternative sequence | 247 – 748 | 502 | Missing in isoform 4. | VSP_023718 | |||||
Experimental info | |||||||||
| Mutagenesis | 175 | 1 | R → A: Loss of function. Ref.6 Ref.7 | ||||||
| Mutagenesis | 175 | 1 | R → K: Does not abolish the effect on actin stress fibers but moderates its capability to induce membrane protrusions. Ref.6 Ref.7 | ||||||
| Sequence conflict | 140 | 1 | T → A in BAC03606. Ref.2 | ||||||
| Sequence conflict | 357 | 1 | Q → L in CAB66581. Ref.1 | ||||||
| Sequence conflict | 722 | 1 | M → V in BAC03606. Ref.2 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Towards a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs." Wiemann S., Weil B., Wellenreuther R., Gassenhuber J., Glassl S., Ansorge W., Boecher M., Bloecker H., Bauersachs S., Blum H., Lauber J., Duesterhoeft A., Beyer A., Koehrer K., Strack N., Mewes H.-W., Ottenwaelder B., Obermaier B. Poustka A.Genome Res. 11:422-435(2001) [PubMed: 11230166] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Brain. |
| [2] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 5). Tissue: Spleen and Tongue. |
| [3] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3 AND 4). Tissue: Chondrosarcoma. |
| [4] | "Immunomic analysis of human sarcoma." Lee S.-Y., Obata Y., Yoshida M., Stockert E., Williamson B., Jungbluth A.A., Chen Y.-T., Old L.J., Scanlan M.J. Proc. Natl. Acad. Sci. U.S.A. 100:2651-2656(2003) [PubMed: 12601173] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 233-510. |
| [5] | "Identification and characterization of ARHGAP24 and ARHGAP25 genes in silico." Katoh M., Katoh M. Int. J. Mol. Med. 14:333-338(2004) [PubMed: 15254788] [Abstract] Cited for: IDENTIFICATION. |
| [6] | "A vascular cell-restricted RhoGAP, p73RhoGAP, is a key regulator of angiogenesis." Su Z.-J., Hahn C.N., Goodall G.J., Reck N.M., Leske A.F., Davy A., Kremmidiotis G., Vadas M.A., Gamble J.R. Proc. Natl. Acad. Sci. U.S.A. 101:12212-12217(2004) [PubMed: 15302923] [Abstract] Cited for: FUNCTION, TISSUE SPECIFICITY, INDUCTION, MUTAGENESIS OF ARG-175. |
| [7] | "Characterization of a novel GTPase-activating protein associated with focal adhesions and the actin cytoskeleton." Lavelin I., Geiger B. J. Biol. Chem. 280:7178-7185(2005) [PubMed: 15611138] [Abstract] Cited for: FUNCTION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY, MUTAGENESIS OF ARG-175. |
| [8] | "FilGAP, a Rho- and ROCK-regulated GAP for Rac binds filamin A to control actin remodelling." Ohta Y., Hartwig J.H., Stossel T.P. Nat. Cell Biol. 8:803-814(2006) [PubMed: 16862148] [Abstract] Cited for: FUNCTION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY, INTERACTION WITH FLNA, PHOSPHORYLATION AT SER-391; SER-402; SER-413; SER-415; SER-437 AND THR-452. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| AL136646 mRNA. Translation: CAB66581.1. AK091196 mRNA. Translation: BAC03606.1. AK130576 mRNA. Translation: BAC85384.1. BC047918 mRNA. Translation: AAH47918.1. BC098580 mRNA. Translation: AAH98580.1. AY211925 mRNA. Translation: AAO65178.1. Frameshift. | |
| IPI | IPI00010448. IPI00166301. IPI00442526. IPI00783816. IPI00829821. |
| PIR | A59430. |
| RefSeq | NP_001020787.2. NP_001036134.1. NP_112595.2. |
| UniGene | Hs.444229 |
3D structure databases | |
| HSSP | HSSP built from PDB template 1V89 based on UniProtKB P42331. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q8N264. 4 interactions. |
| STRING | Q8N264. |
PTM databases | |
| PhosphoSite | Q8N264. |
Genome annotation databases | |
| Ensembl | ENST00000318116; ENSP00000315334; ENSG00000138639; Homo sapiens. [Genome view] ENST00000395184; ENSP00000378611; ENSG00000138639; Homo sapiens. [Genome view] |
| GeneID | 83478. |
| KEGG | hsa:83478. |
| UCSC | uc003hpj.2. human. uc003hpk.1. human. uc003hpl.1. human. uc003hpm.1. human. |
Organism-specific databases | |
| CTD | 83478. |
| GeneCards | GC04P086615. |
| HGNC | HGNC:25361. ARHGAP24. |
| HPA | HPA014288. |
| MIM | 610586. gene. |
| PharmGKB | PA134934054. |
| GenAtlas | Search... |
Phylogenomic databases | |
| HOVERGEN | Q8N264. |
| OMA | CRSSTTT |
| OrthoDB | EOG92Z78W |
Enzyme and pathway databases | |
| Reactome | REACT_11044. Signaling by Rho GTPases. |
Gene expression databases | |
| ArrayExpress | Q8N264. |
| Bgee | Q8N264. |
| CleanEx | HS_ARHGAP24. |
| Genevestigator | Q8N264. |
Family and domain databases | |
| InterPro | IPR011993. PH_type. IPR001849. Pleckstrin_homology. IPR008936. Rho_GTPase_activation_prot. IPR000198. RhoGAP. [Graphical view] |
| Gene3D | G3DSA:2.30.29.30. PH_type. 1 hit. G3DSA:1.10.555.10. RhoGAP. 1 hit. |
| Pfam | PF00169. PH. 1 hit. PF00620. RhoGAP. 1 hit. [Graphical view] |
| SMART | SM00233. PH. 1 hit. SM00324. RhoGAP. 1 hit. [Graphical view] |
| PROSITE | PS50003. PH_DOMAIN. 1 hit. PS50238. RHOGAP. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other Resources | |
| NextBio | 72411. |
| SOURCE | Search... |
Entry information
| Entry name | RHG24_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q8N264 Secondary accession number(s): Q4KMG1 Q9H0T6 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 4 Human chromosome 4: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with


