Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Rho GTPase-activating protein 24

Gene

ARHGAP24

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Rho GTPase-activating protein involved in cell polarity, cell morphology and cytoskeletal organization. Acts as a GTPase activator for the Rac-type GTPase by converting it to an inactive GDP-bound state. Controls actin remodeling by inactivating Rac downstream of Rho leading to suppress leading edge protrusion and promotes cell retraction to achieve cellular polarity. Able to suppress RAC1 and CDC42 activity in vitro. Overexpression induces cell rounding with partial or complete disruption of actin stress fibers and formation of membrane ruffles, lamellipodia, and filopodia. Isoform 2 is a vascular cell-specific GAP involved in modulation of angiogenesis.3 Publications

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Developmental protein, GTPase activation

Keywords - Biological processi

Angiogenesis, Differentiation

Enzyme and pathway databases

ReactomeiREACT_11051. Rho GTPase cycle.

Names & Taxonomyi

Protein namesi
Recommended name:
Rho GTPase-activating protein 24
Alternative name(s):
Filamin-A-associated RhoGAP
Short name:
FilGAP
RAC1- and CDC42-specific GTPase-activating protein of 72 kDa
Short name:
RC-GAP72
Rho-type GTPase-activating protein 24
RhoGAP of 73 kDa
Sarcoma antigen NY-SAR-88
p73RhoGAP
Gene namesi
Name:ARHGAP24
Synonyms:FILGAP
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640 Componenti: Chromosome 4

Organism-specific databases

HGNCiHGNC:25361. ARHGAP24.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cell junction, Cell projection, Cytoplasm, Cytoskeleton

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi175 – 1751R → A: Loss of function. 2 Publications
Mutagenesisi175 – 1751R → K: Does not abolish the effect on actin stress fibers but moderates its capability to induce membrane protrusions. 2 Publications

Organism-specific databases

Orphaneti93213. Familial idiopathic steroid-resistant nephrotic syndrome with focal segmental hyalinosis.
PharmGKBiPA134934054.

Polymorphism and mutation databases

BioMutaiARHGAP24.
DMDMi134035016.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 748748Rho GTPase-activating protein 24PRO_0000280473Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei391 – 3911Phosphoserine1 Publication
Modified residuei402 – 4021Phosphoserine1 Publication
Modified residuei413 – 4131Phosphoserine1 Publication
Modified residuei415 – 4151Phosphoserine1 Publication
Modified residuei437 – 4371Phosphoserine1 Publication
Modified residuei452 – 4521Phosphothreonine1 Publication

Post-translational modificationi

Phosphorylated by ROCK, leading to activate the RacGAP activity.1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ8N264.
PaxDbiQ8N264.
PRIDEiQ8N264.

PTM databases

PhosphoSiteiQ8N264.

Expressioni

Tissue specificityi

Isoform 1 is widely expressed with a higher level in kidney. Isoform 2 is mainly expressed in endothelial cells.3 Publications

Inductioni

Isoform 2 is up-regulated during capillary tube formation in umbilical vein endothelial cells.1 Publication

Gene expression databases

BgeeiQ8N264.
CleanExiHS_ARHGAP24.
ExpressionAtlasiQ8N264. baseline and differential.
GenevisibleiQ8N264. HS.

Organism-specific databases

HPAiHPA014288.

Interactioni

Subunit structurei

Interacts with FLNA.1 Publication

Binary interactionsi

WithEntry#Exp.IntActNotes
FLNAP213336EBI-988764,EBI-350432
HTTP428583EBI-988764,EBI-466029

Protein-protein interaction databases

BioGridi123663. 1 interaction.
DIPiDIP-35520N.
IntActiQ8N264. 4 interactions.
MINTiMINT-4725530.
STRINGi9606.ENSP00000378611.

Structurei

3D structure databases

ProteinModelPortaliQ8N264.
SMRiQ8N264. Positions 16-320.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini19 – 125107PHPROSITE-ProRule annotationAdd
BLAST
Domaini135 – 329195Rho-GAPPROSITE-ProRule annotationAdd
BLAST

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili649 – 72981Sequence AnalysisAdd
BLAST

Domaini

The coiled coil domain mediates the interaction with FLNA leading to its recruitment to lamellae.

Sequence similaritiesi

Contains 1 PH domain.PROSITE-ProRule annotation
Contains 1 Rho-GAP domain.PROSITE-ProRule annotation

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiNOG246008.
GeneTreeiENSGT00760000118863.
HOGENOMiHOG000232151.
HOVERGENiHBG058875.
InParanoidiQ8N264.
OMAiSHENRMN.
OrthoDBiEOG79W94M.
PhylomeDBiQ8N264.
TreeFamiTF323577.

Family and domain databases

Gene3Di1.10.555.10. 1 hit.
2.30.29.30. 1 hit.
InterProiIPR011993. PH-like_dom.
IPR001849. PH_domain.
IPR008936. Rho_GTPase_activation_prot.
IPR000198. RhoGAP_dom.
[Graphical view]
PfamiPF00169. PH. 1 hit.
PF00620. RhoGAP. 1 hit.
[Graphical view]
SMARTiSM00233. PH. 1 hit.
SM00324. RhoGAP. 1 hit.
[Graphical view]
SUPFAMiSSF48350. SSF48350. 1 hit.
PROSITEiPS50003. PH_DOMAIN. 1 hit.
PS50238. RHOGAP. 1 hit.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8N264-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MEENNDSTEN PQQGQGRQNA IKCGWLRKQG GFVKTWHTRW FVLKGDQLYY
60 70 80 90 100
FKDEDETKPL GTIFLPGNKV SEHPCNEENP GKFLFEVVPG GDRDRMTANH
110 120 130 140 150
ESYLLMASTQ NDMEDWVKSI RRVIWGPFGG GIFGQKLEDT VRYEKRYGNR
160 170 180 190 200
LAPMLVEQCV DFIRQRGLKE EGLFRLPGQA NLVKELQDAF DCGEKPSFDS
210 220 230 240 250
NTDVHTVASL LKLYLRELPE PVIPYAKYED FLSCAKLLSK EEEAGVKELA
260 270 280 290 300
KQVKSLPVVN YNLLKYICRF LDEVQSYSGV NKMSVQNLAT VFGPNILRPK
310 320 330 340 350
VEDPLTIMEG TVVVQQLMSV MISKHDCLFP KDAELQSKPQ DGVSNNNEIQ
360 370 380 390 400
KKATMGQLQN KENNNTKDSP SRQCSWDKSE SPQRSSMNNG SPTALSGSKT
410 420 430 440 450
NSPKNSVHKL DVSRSPPLMV KKNPAFNKGS GIVTNGSFSS SNAEGLEKTQ
460 470 480 490 500
TTPNGSLQAR RSSSLKVSGT KMGTHSVQNG TVRMGILNSD TLGNPTNVRN
510 520 530 540 550
MSWLPNGYVT LRDNKQKEQA GELGQHNRLS TYDNVHQQFS MMNLDDKQSI
560 570 580 590 600
DSATWSTSSC EISLPENSNS CRSSTTTCPE QDFFGGNFED PVLDGPPQDD
610 620 630 640 650
LSHPRDYESK SDHRSVGGRS SRATSSSDNS ETFVGNSSSN HSALHSLVSS
660 670 680 690 700
LKQEMTKQKI EYESRIKSLE QRNLTLETEM MSLHDELDQE RKKFTMIEIK
710 720 730 740
MRNAERAKED AEKRNDMLQK EMEQFFSTFG ELTVEPRRTE RGNTIWIQ
Length:748
Mass (Da):84,258
Last modified:March 20, 2007 - v2
Checksum:i87A8E6DCA6869229
GO
Isoform 2 (identifier: Q8N264-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-93: Missing.
     94-130: DRMTANHESYLLMASTQNDMEDWVKSIRRVIWGPFGG → MPEDRNSGGCPAGALASTPFIPKTTYRRIKRCFSFRK

Show »
Length:655
Mass (Da):73,409
Checksum:i1497D420E9DD3FE5
GO
Isoform 3 (identifier: Q8N264-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-95: Missing.

Show »
Length:653
Mass (Da):73,290
Checksum:iF6A68FEF1E0A5564
GO
Isoform 4 (identifier: Q8N264-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     245-246: GV → VS
     247-748: Missing.

Note: No experimental confirmation available.
Show »
Length:246
Mass (Da):28,249
Checksum:i9AC9E1CA3D589430
GO
Isoform 5 (identifier: Q8N264-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MWLRKKDWQI...QQGKSISLIM
     91-94: GDRD → KIFS
     95-748: Missing.

Note: No experimental confirmation available.
Show »
Length:239
Mass (Da):28,221
Checksum:i44E3F4574FA33D77
GO

Sequence cautioni

The sequence AAO65178.1 differs from that shown. Reason: Frameshift at several positions. Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti140 – 1401T → A in BAC03606 (PubMed:14702039).Curated
Sequence conflicti357 – 3571Q → L in CAB66581 (PubMed:11230166).Curated
Sequence conflicti722 – 7221M → V in BAC03606 (PubMed:14702039).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 9595Missing in isoform 3. 1 PublicationVSP_023711Add
BLAST
Alternative sequencei1 – 9393Missing in isoform 2. 1 PublicationVSP_023712Add
BLAST
Alternative sequencei1 – 11M → MWLRKKDWQIFNEQFLKKEH AVGFCFSKCVLVEFSLKCFK KIKSSYWNNDALAFLGKKFL REKNKMTKKQTRNRQNKFPP KPALRSSPVHRVQHFPLLWK VKEPHYHLFFFAFSYCWSWE PFPSEQQPCPASVLSSQQGK SISLIM in isoform 5. 1 PublicationVSP_023713
Alternative sequencei91 – 944GDRD → KIFS in isoform 5. 1 PublicationVSP_023714
Alternative sequencei94 – 13037DRMTA…GPFGG → MPEDRNSGGCPAGALASTPF IPKTTYRRIKRCFSFRK in isoform 2. 1 PublicationVSP_023715Add
BLAST
Alternative sequencei95 – 748654Missing in isoform 5. 1 PublicationVSP_023716Add
BLAST
Alternative sequencei245 – 2462GV → VS in isoform 4. 1 PublicationVSP_023717
Alternative sequencei247 – 748502Missing in isoform 4. 1 PublicationVSP_023718Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AL136646 mRNA. Translation: CAB66581.1.
AK091196 mRNA. Translation: BAC03606.1.
AK130576 mRNA. Translation: BAC85384.1.
BC047918 mRNA. Translation: AAH47918.1.
BC098580 mRNA. Translation: AAH98580.1.
AY211925 mRNA. Translation: AAO65178.1. Frameshift.
CCDSiCCDS34025.1. [Q8N264-1]
CCDS3611.1. [Q8N264-2]
CCDS43246.1. [Q8N264-3]
PIRiA59430.
RefSeqiNP_001020787.2. NM_001025616.2. [Q8N264-1]
NP_001036134.1. NM_001042669.1. [Q8N264-3]
NP_112595.2. NM_031305.2. [Q8N264-2]
XP_005263320.1. XM_005263263.3. [Q8N264-1]
XP_011530602.1. XM_011532300.1. [Q8N264-3]
UniGeneiHs.444229.

Genome annotation databases

EnsembliENST00000264343; ENSP00000264343; ENSG00000138639. [Q8N264-2]
ENST00000395183; ENSP00000378610; ENSG00000138639. [Q8N264-3]
ENST00000395184; ENSP00000378611; ENSG00000138639.
ENST00000503995; ENSP00000423206; ENSG00000138639. [Q8N264-4]
GeneIDi83478.
KEGGihsa:83478.
UCSCiuc003hpj.3. human. [Q8N264-4]
uc003hpk.3. human. [Q8N264-1]
uc003hpm.3. human. [Q8N264-2]
uc010ikf.3. human. [Q8N264-3]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AL136646 mRNA. Translation: CAB66581.1.
AK091196 mRNA. Translation: BAC03606.1.
AK130576 mRNA. Translation: BAC85384.1.
BC047918 mRNA. Translation: AAH47918.1.
BC098580 mRNA. Translation: AAH98580.1.
AY211925 mRNA. Translation: AAO65178.1. Frameshift.
CCDSiCCDS34025.1. [Q8N264-1]
CCDS3611.1. [Q8N264-2]
CCDS43246.1. [Q8N264-3]
PIRiA59430.
RefSeqiNP_001020787.2. NM_001025616.2. [Q8N264-1]
NP_001036134.1. NM_001042669.1. [Q8N264-3]
NP_112595.2. NM_031305.2. [Q8N264-2]
XP_005263320.1. XM_005263263.3. [Q8N264-1]
XP_011530602.1. XM_011532300.1. [Q8N264-3]
UniGeneiHs.444229.

3D structure databases

ProteinModelPortaliQ8N264.
SMRiQ8N264. Positions 16-320.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi123663. 1 interaction.
DIPiDIP-35520N.
IntActiQ8N264. 4 interactions.
MINTiMINT-4725530.
STRINGi9606.ENSP00000378611.

PTM databases

PhosphoSiteiQ8N264.

Polymorphism and mutation databases

BioMutaiARHGAP24.
DMDMi134035016.

Proteomic databases

MaxQBiQ8N264.
PaxDbiQ8N264.
PRIDEiQ8N264.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000264343; ENSP00000264343; ENSG00000138639. [Q8N264-2]
ENST00000395183; ENSP00000378610; ENSG00000138639. [Q8N264-3]
ENST00000395184; ENSP00000378611; ENSG00000138639.
ENST00000503995; ENSP00000423206; ENSG00000138639. [Q8N264-4]
GeneIDi83478.
KEGGihsa:83478.
UCSCiuc003hpj.3. human. [Q8N264-4]
uc003hpk.3. human. [Q8N264-1]
uc003hpm.3. human. [Q8N264-2]
uc010ikf.3. human. [Q8N264-3]

Organism-specific databases

CTDi83478.
GeneCardsiGC04P086396.
H-InvDBHIX0004350.
HGNCiHGNC:25361. ARHGAP24.
HPAiHPA014288.
MIMi610586. gene.
neXtProtiNX_Q8N264.
Orphaneti93213. Familial idiopathic steroid-resistant nephrotic syndrome with focal segmental hyalinosis.
PharmGKBiPA134934054.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiNOG246008.
GeneTreeiENSGT00760000118863.
HOGENOMiHOG000232151.
HOVERGENiHBG058875.
InParanoidiQ8N264.
OMAiSHENRMN.
OrthoDBiEOG79W94M.
PhylomeDBiQ8N264.
TreeFamiTF323577.

Enzyme and pathway databases

ReactomeiREACT_11051. Rho GTPase cycle.

Miscellaneous databases

ChiTaRSiARHGAP24. human.
GeneWikiiARHGAP24.
GenomeRNAii83478.
NextBioi72411.
PROiQ8N264.
SOURCEiSearch...

Gene expression databases

BgeeiQ8N264.
CleanExiHS_ARHGAP24.
ExpressionAtlasiQ8N264. baseline and differential.
GenevisibleiQ8N264. HS.

Family and domain databases

Gene3Di1.10.555.10. 1 hit.
2.30.29.30. 1 hit.
InterProiIPR011993. PH-like_dom.
IPR001849. PH_domain.
IPR008936. Rho_GTPase_activation_prot.
IPR000198. RhoGAP_dom.
[Graphical view]
PfamiPF00169. PH. 1 hit.
PF00620. RhoGAP. 1 hit.
[Graphical view]
SMARTiSM00233. PH. 1 hit.
SM00324. RhoGAP. 1 hit.
[Graphical view]
SUPFAMiSSF48350. SSF48350. 1 hit.
PROSITEiPS50003. PH_DOMAIN. 1 hit.
PS50238. RHOGAP. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Brain.
  2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 5).
    Tissue: Spleen and Tongue.
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3 AND 4).
    Tissue: Chondrosarcoma.
  4. Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 233-510.
  5. "Identification and characterization of ARHGAP24 and ARHGAP25 genes in silico."
    Katoh M., Katoh M.
    Int. J. Mol. Med. 14:333-338(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION.
  6. Cited for: FUNCTION, TISSUE SPECIFICITY, INDUCTION, MUTAGENESIS OF ARG-175.
  7. "Characterization of a novel GTPase-activating protein associated with focal adhesions and the actin cytoskeleton."
    Lavelin I., Geiger B.
    J. Biol. Chem. 280:7178-7185(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY, MUTAGENESIS OF ARG-175.
  8. "FilGAP, a Rho- and ROCK-regulated GAP for Rac binds filamin A to control actin remodelling."
    Ohta Y., Hartwig J.H., Stossel T.P.
    Nat. Cell Biol. 8:803-814(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY, INTERACTION WITH FLNA, PHOSPHORYLATION AT SER-391; SER-402; SER-413; SER-415; SER-437 AND THR-452.

Entry informationi

Entry nameiRHG24_HUMAN
AccessioniPrimary (citable) accession number: Q8N264
Secondary accession number(s): Q4KMG1
, Q6ZNV3, Q86TI5, Q86WE4, Q9H0T6
Entry historyi
Integrated into UniProtKB/Swiss-Prot: March 20, 2007
Last sequence update: March 20, 2007
Last modified: July 22, 2015
This is version 109 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 4
    Human chromosome 4: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.