Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Rho GTPase-activating protein 24

Gene

ARHGAP24

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Rho GTPase-activating protein involved in cell polarity, cell morphology and cytoskeletal organization. Acts as a GTPase activator for the Rac-type GTPase by converting it to an inactive GDP-bound state. Controls actin remodeling by inactivating Rac downstream of Rho leading to suppress leading edge protrusion and promotes cell retraction to achieve cellular polarity. Able to suppress RAC1 and CDC42 activity in vitro. Overexpression induces cell rounding with partial or complete disruption of actin stress fibers and formation of membrane ruffles, lamellipodia, and filopodia. Isoform 2 is a vascular cell-specific GAP involved in modulation of angiogenesis.3 Publications

Caution

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionDevelopmental protein, GTPase activation
Biological processAngiogenesis, Differentiation

Enzyme and pathway databases

ReactomeiR-HSA-194840 Rho GTPase cycle
SIGNORiQ8N264

Names & Taxonomyi

Protein namesi
Recommended name:
Rho GTPase-activating protein 24
Alternative name(s):
Filamin-A-associated RhoGAP
Short name:
FilGAP
RAC1- and CDC42-specific GTPase-activating protein of 72 kDa
Short name:
RC-GAP72
Rho-type GTPase-activating protein 24
RhoGAP of 73 kDa
Sarcoma antigen NY-SAR-88
p73RhoGAP
Gene namesi
Name:ARHGAP24
Synonyms:FILGAP
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 4

Organism-specific databases

EuPathDBiHostDB:ENSG00000138639.17
HGNCiHGNC:25361 ARHGAP24
MIMi610586 gene
neXtProtiNX_Q8N264

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell junction, Cell projection, Cytoplasm, Cytoskeleton

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi175R → A: Loss of function. 2 Publications1
Mutagenesisi175R → K: Does not abolish the effect on actin stress fibers but moderates its capability to induce membrane protrusions. 2 Publications1

Organism-specific databases

DisGeNETi83478
MalaCardsiARHGAP24
OpenTargetsiENSG00000138639
Orphaneti93213 Familial idiopathic steroid-resistant nephrotic syndrome with focal segmental hyalinosis
PharmGKBiPA134934054

Polymorphism and mutation databases

BioMutaiARHGAP24
DMDMi134035016

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002804731 – 748Rho GTPase-activating protein 24Add BLAST748

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei369PhosphoserineBy similarity1
Modified residuei391Phosphoserine1 Publication1
Modified residuei396PhosphoserineBy similarity1
Modified residuei398PhosphoserineBy similarity1
Modified residuei402Phosphoserine1 Publication1
Modified residuei413Phosphoserine1 Publication1
Modified residuei415PhosphoserineCombined sources1 Publication1
Modified residuei437Phosphoserine1 Publication1
Modified residuei452Phosphothreonine1 Publication1

Post-translational modificationi

Phosphorylated by ROCK, leading to activate the RacGAP activity.1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ8N264
PaxDbiQ8N264
PeptideAtlasiQ8N264
PRIDEiQ8N264

PTM databases

iPTMnetiQ8N264
PhosphoSitePlusiQ8N264

Expressioni

Tissue specificityi

Isoform 1 is widely expressed with a higher level in kidney. Isoform 2 is mainly expressed in endothelial cells.3 Publications

Inductioni

Isoform 2 is up-regulated during capillary tube formation in umbilical vein endothelial cells.1 Publication

Gene expression databases

BgeeiENSG00000138639
CleanExiHS_ARHGAP24
ExpressionAtlasiQ8N264 baseline and differential
GenevisibleiQ8N264 HS

Organism-specific databases

HPAiHPA014288

Interactioni

Subunit structurei

Interacts with FLNA.1 Publication

Binary interactionsi

Show more details

Protein-protein interaction databases

BioGridi1236631 interactor.
DIPiDIP-35520N
IntActiQ8N264 4 interactors.
STRINGi9606.ENSP00000378611

Structurei

3D structure databases

ProteinModelPortaliQ8N264
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini19 – 125PHPROSITE-ProRule annotationAdd BLAST107
Domaini135 – 329Rho-GAPPROSITE-ProRule annotationAdd BLAST195

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili649 – 729Sequence analysisAdd BLAST81

Domaini

The coiled coil domain mediates the interaction with FLNA leading to its recruitment to lamellae.

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiKOG4270 Eukaryota
ENOG410XRR2 LUCA
GeneTreeiENSGT00760000118863
HOGENOMiHOG000232151
HOVERGENiHBG058875
InParanoidiQ8N264
KOiK20642
OMAiLLKYICR
OrthoDBiEOG091G02DD
PhylomeDBiQ8N264
TreeFamiTF323577

Family and domain databases

Gene3Di1.10.555.101 hit
2.30.29.301 hit
InterProiView protein in InterPro
IPR011993 PH-like_dom_sf
IPR001849 PH_domain
IPR008936 Rho_GTPase_activation_prot
IPR000198 RhoGAP_dom
PfamiView protein in Pfam
PF00169 PH, 1 hit
PF00620 RhoGAP, 1 hit
SMARTiView protein in SMART
SM00233 PH, 1 hit
SM00324 RhoGAP, 1 hit
SUPFAMiSSF48350 SSF48350, 1 hit
PROSITEiView protein in PROSITE
PS50003 PH_DOMAIN, 1 hit
PS50238 RHOGAP, 1 hit

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8N264-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MEENNDSTEN PQQGQGRQNA IKCGWLRKQG GFVKTWHTRW FVLKGDQLYY
60 70 80 90 100
FKDEDETKPL GTIFLPGNKV SEHPCNEENP GKFLFEVVPG GDRDRMTANH
110 120 130 140 150
ESYLLMASTQ NDMEDWVKSI RRVIWGPFGG GIFGQKLEDT VRYEKRYGNR
160 170 180 190 200
LAPMLVEQCV DFIRQRGLKE EGLFRLPGQA NLVKELQDAF DCGEKPSFDS
210 220 230 240 250
NTDVHTVASL LKLYLRELPE PVIPYAKYED FLSCAKLLSK EEEAGVKELA
260 270 280 290 300
KQVKSLPVVN YNLLKYICRF LDEVQSYSGV NKMSVQNLAT VFGPNILRPK
310 320 330 340 350
VEDPLTIMEG TVVVQQLMSV MISKHDCLFP KDAELQSKPQ DGVSNNNEIQ
360 370 380 390 400
KKATMGQLQN KENNNTKDSP SRQCSWDKSE SPQRSSMNNG SPTALSGSKT
410 420 430 440 450
NSPKNSVHKL DVSRSPPLMV KKNPAFNKGS GIVTNGSFSS SNAEGLEKTQ
460 470 480 490 500
TTPNGSLQAR RSSSLKVSGT KMGTHSVQNG TVRMGILNSD TLGNPTNVRN
510 520 530 540 550
MSWLPNGYVT LRDNKQKEQA GELGQHNRLS TYDNVHQQFS MMNLDDKQSI
560 570 580 590 600
DSATWSTSSC EISLPENSNS CRSSTTTCPE QDFFGGNFED PVLDGPPQDD
610 620 630 640 650
LSHPRDYESK SDHRSVGGRS SRATSSSDNS ETFVGNSSSN HSALHSLVSS
660 670 680 690 700
LKQEMTKQKI EYESRIKSLE QRNLTLETEM MSLHDELDQE RKKFTMIEIK
710 720 730 740
MRNAERAKED AEKRNDMLQK EMEQFFSTFG ELTVEPRRTE RGNTIWIQ
Length:748
Mass (Da):84,258
Last modified:March 20, 2007 - v2
Checksum:i87A8E6DCA6869229
GO
Isoform 2 (identifier: Q8N264-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-93: Missing.
     94-130: DRMTANHESYLLMASTQNDMEDWVKSIRRVIWGPFGG → MPEDRNSGGCPAGALASTPFIPKTTYRRIKRCFSFRK

Show »
Length:655
Mass (Da):73,409
Checksum:i1497D420E9DD3FE5
GO
Isoform 3 (identifier: Q8N264-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-95: Missing.

Show »
Length:653
Mass (Da):73,290
Checksum:iF6A68FEF1E0A5564
GO
Isoform 4 (identifier: Q8N264-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     245-246: GV → VS
     247-748: Missing.

Note: No experimental confirmation available.
Show »
Length:246
Mass (Da):28,249
Checksum:i9AC9E1CA3D589430
GO
Isoform 5 (identifier: Q8N264-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MWLRKKDWQI...QQGKSISLIM
     91-94: GDRD → KIFS
     95-748: Missing.

Note: No experimental confirmation available.
Show »
Length:239
Mass (Da):28,221
Checksum:i44E3F4574FA33D77
GO

Sequence cautioni

The sequence AAO65178 differs from that shown. Reason: Frameshift at several positions.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti140T → A in BAC03606 (PubMed:14702039).Curated1
Sequence conflicti357Q → L in CAB66581 (PubMed:11230166).Curated1
Sequence conflicti722M → V in BAC03606 (PubMed:14702039).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0237111 – 95Missing in isoform 3. 1 PublicationAdd BLAST95
Alternative sequenceiVSP_0237121 – 93Missing in isoform 2. 1 PublicationAdd BLAST93
Alternative sequenceiVSP_0237131M → MWLRKKDWQIFNEQFLKKEH AVGFCFSKCVLVEFSLKCFK KIKSSYWNNDALAFLGKKFL REKNKMTKKQTRNRQNKFPP KPALRSSPVHRVQHFPLLWK VKEPHYHLFFFAFSYCWSWE PFPSEQQPCPASVLSSQQGK SISLIM in isoform 5. 1 Publication1
Alternative sequenceiVSP_02371491 – 94GDRD → KIFS in isoform 5. 1 Publication4
Alternative sequenceiVSP_02371594 – 130DRMTA…GPFGG → MPEDRNSGGCPAGALASTPF IPKTTYRRIKRCFSFRK in isoform 2. 1 PublicationAdd BLAST37
Alternative sequenceiVSP_02371695 – 748Missing in isoform 5. 1 PublicationAdd BLAST654
Alternative sequenceiVSP_023717245 – 246GV → VS in isoform 4. 1 Publication2
Alternative sequenceiVSP_023718247 – 748Missing in isoform 4. 1 PublicationAdd BLAST502

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AL136646 mRNA Translation: CAB66581.1
AK091196 mRNA Translation: BAC03606.1
AK130576 mRNA Translation: BAC85384.1
BC047918 mRNA Translation: AAH47918.1
BC098580 mRNA Translation: AAH98580.1
AY211925 mRNA Translation: AAO65178.1 Frameshift.
CCDSiCCDS34025.1 [Q8N264-1]
CCDS3611.1 [Q8N264-2]
CCDS43246.1 [Q8N264-3]
PIRiA59430
RefSeqiNP_001020787.2, NM_001025616.2 [Q8N264-1]
NP_001036134.1, NM_001042669.1 [Q8N264-3]
NP_112595.2, NM_031305.2 [Q8N264-2]
XP_011530602.1, XM_011532300.2 [Q8N264-3]
UniGeneiHs.444229
Hs.689398

Genome annotation databases

EnsembliENST00000264343; ENSP00000264343; ENSG00000138639 [Q8N264-2]
ENST00000395183; ENSP00000378610; ENSG00000138639 [Q8N264-3]
ENST00000395184; ENSP00000378611; ENSG00000138639 [Q8N264-1]
ENST00000503995; ENSP00000423206; ENSG00000138639 [Q8N264-4]
GeneIDi83478
KEGGihsa:83478
UCSCiuc003hpj.4 human [Q8N264-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiRHG24_HUMAN
AccessioniPrimary (citable) accession number: Q8N264
Secondary accession number(s): Q4KMG1
, Q6ZNV3, Q86TI5, Q86WE4, Q9H0T6
Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 20, 2007
Last sequence update: March 20, 2007
Last modified: March 28, 2018
This is version 132 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome