Q8N1V2 (WDR16_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 78.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: WD repeat-containing protein 16 Alternative name(s): WD40-repeat protein up-regulated in HCC | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 620 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | May play an essential role in the growth or survival of hepatocellular carcinoma (HCC). Ref.1 |
| Subcellular location | |
| Tissue specificity | Highly expressed in testis. Up-regulated in hepatocellular carcinoma (HCC). Ref.1 |
| Miscellaneous | May be a good candidate as a diagnostic marker for HCC as well as a potential molecular target for development of novel therapeutic drugs. |
| Sequence similarities | Contains 11 WD repeats. |
| Sequence caution | The sequence BAB85083.1 differs from that shown. Reason: Frameshift at position 183. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cytoplasm |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Repeat WD repeat |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Cellular component | cytoplasm Inferred from direct assay. Source: HPA intracellular membrane-bounded organelleInferred from direct assay. Source: HPA |
| Molecular function | protein binding Inferred from physical interaction Ref.1. Source: UniProtKB |
| Complete GO annotation... | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q8N1V2-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q8N1V2-2) The sequence of this isoform differs from the canonical sequence as follows: 1-23: MDNKISPEAQVAELELDAVIGFN → MEAVVLPWQIFGVRELPVERGVTMKGPRLFRAP | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: Q8N1V2-3) The sequence of this isoform differs from the canonical sequence as follows: 24-91: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 620 | 620 | WD repeat-containing protein 16 | PRO_0000233153 | |||||
Regions | |||||||||
| Repeat | 62 – 106 | 45 | WD 1 | ||||||
| Repeat | 109 – 150 | 42 | WD 2 | ||||||
| Repeat | 156 – 195 | 40 | WD 3 | ||||||
| Repeat | 288 – 327 | 40 | WD 4 | ||||||
| Repeat | 330 – 369 | 40 | WD 5 | ||||||
| Repeat | 372 – 411 | 40 | WD 6 | ||||||
| Repeat | 415 – 454 | 40 | WD 7 | ||||||
| Repeat | 459 – 498 | 40 | WD 8 | ||||||
| Repeat | 500 – 539 | 40 | WD 9 | ||||||
| Repeat | 543 – 582 | 40 | WD 10 | ||||||
| Repeat | 585 – 620 | 36 | WD 11 | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 23 | 23 | MDNKI…VIGFN → MEAVVLPWQIFGVRELPVER GVTMKGPRLFRAP in isoform 2. | VSP_018067 | |||||
| Alternative sequence | 24 – 91 | 68 | Missing in isoform 3. | VSP_018068 | |||||
| Natural variant | 336 | 1 | E → K. Ref.2 Ref.4 Corresponds to variant rs6503235 [ dbSNP | Ensembl ]. | VAR_026057 | |||||
Experimental info | |||||||||
| Sequence conflict | 91 | 1 | A → V in AAH25392. Ref.4 | ||||||
| Sequence conflict | 199 | 1 | C → S in AAH25392. Ref.4 | ||||||
| Sequence conflict | 243 | 1 | G → E in BAB85083. Ref.2 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "WDRPUH, a novel WD-repeat-containing protein, is highly expressed in human hepatocellular carcinoma and involved in cell proliferation." Silva F.P., Hamamoto R., Nakamura Y., Furukawa Y. Neoplasia 7:348-355(2005) [PubMed: 15967112] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, INTERACTION WITH HSP70; CCT CHAPERONIN COMPLEX AND BRCA2, SUBCELLULAR LOCATION, TISSUE SPECIFICITY. |
| [2] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2 AND 3), VARIANT LYS-336. Tissue: Caudate nucleus, Lung and Testis. |
| [3] | "DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage." Zody M.C., Garber M., Adams D.J., Sharpe T., Harrow J., Lupski J.R., Nicholson C., Searle S.M., Wilming L., Young S.K., Abouelleil A., Allen N.R., Bi W., Bloom T., Borowsky M.L., Bugalter B.E., Butler J., Chang J.L. Nusbaum C.Nature 440:1045-1049(2006) [PubMed: 16625196] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT LYS-336. Tissue: Testis. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AB065281 mRNA. Translation: BAB83743.1. AK074435 mRNA. Translation: BAB85083.1. Frameshift. AK094847 mRNA. Translation: BAC04435.1. AK315679 mRNA. Translation: BAG38044.1. AC087501 Genomic DNA. No translation available. AC118755 Genomic DNA. No translation available. BC025392 mRNA. Translation: AAH25392.1. |
| IPI | IPI00170961. IPI00184719. IPI00745344. |
| RefSeq | NP_001074025.1. NM_001080556.1. NP_659491.4. NM_145054.4. |
| UniGene | Hs.232270. |
3D structure databases | |
| ProteinModelPortal | Q8N1V2. |
| SMR | Q8N1V2. Positions 28-146, 335-618. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | Q8N1V2. |
PTM databases | |
| PhosphoSite | Q8N1V2. |
Polymorphism databases | |
| DMDM | 146291099. |
Proteomic databases | |
| PRIDE | Q8N1V2. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000352665; ENSP00000339449; ENSG00000166596. |
| GeneID | 146845. |
| KEGG | hsa:146845. |
| UCSC | uc002gly.1. human. uc002glz.1. human. uc010coc.1. human. |
Organism-specific databases | |
| CTD | 146845. |
| GeneCards | GC17P009422. |
| H-InvDB | HIX0013530. |
| HGNC | HGNC:16053. WDR16. |
| HPA | HPA023247. HPA023562. |
| MIM | 609804. gene. |
| neXtProt | NX_Q8N1V2. |
| PharmGKB | PA38084. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | prNOG07909. |
| GeneTree | ENSGT00530000063072. |
| HOVERGEN | HBG055224. |
| OMA | MADDDSF. |
| OrthoDB | EOG4SBDXM. |
| PhylomeDB | Q8N1V2. |
Gene expression databases | |
| ArrayExpress | Q8N1V2. |
| Bgee | Q8N1V2. |
| CleanEx | HS_WDR16. |
| Genevestigator | Q8N1V2. |
| GermOnline | ENSG00000166596. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR015943. WD40/YVTN_repeat-like_dom. IPR001680. WD40_repeat. IPR011046. WD40_repeat-like_dom. IPR019775. WD40_repeat_CS. IPR017986. WD40_repeat_dom. [Graphical view] |
| Gene3D | G3DSA:2.130.10.10. WD40/YVTN_repeat-like. 2 hits. |
| Pfam | PF00400. WD40. 7 hits. [Graphical view] |
| SMART | SM00320. WD40. 11 hits. [Graphical view] |
| SUPFAM | SSF50978. WD40_like. 2 hits. |
| PROSITE | PS00678. WD_REPEATS_1. 2 hits. PS50082. WD_REPEATS_2. 5 hits. PS50294. WD_REPEATS_REGION. 2 hits. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 85465. |
| SOURCE | Search... |
Entry information
| Entry name | WDR16_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q8N1V2 Secondary accession number(s): B2RDU7 Q8TCI3 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 17 Human chromosome 17: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with