Q8N1M1 (BEST3_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 98.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Bestrophin-3 Alternative name(s): Vitelliform macular dystrophy 2-like protein 3 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 668 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Function | Forms calcium-sensitive By similarity chloride channels. Permeable to bicarbonate By similarity. Ref.2 |
| Subcellular location | |
| Tissue specificity | Present in skeletal muscle and weakly in brain, spinal cord, bone marrow and retina. Ref.1 |
| Sequence similarities | Belongs to the bestrophin family. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Ion transport Transport |
| Cellular component | Cell membrane Membrane |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Transmembrane Transmembrane helix |
| Ligand | Calcium Chloride |
| Molecular function | Chloride channel Ion channel |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | negative regulation of ion transport Inferred from electronic annotation. Source: Compara |
| Cellular_component | chloride channel complex Inferred from electronic annotation. Source: UniProtKB-KW plasma membraneInferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular_function | chloride channel activity Inferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 2 (identifier: Q8N1M1-2) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 1 (identifier: Q8N1M1-1) The sequence of this isoform differs from the canonical sequence as follows: 368-398: LSGSDFPDEEWLWDYEKHGHRHSMIRRVKRF → KQMPKNEWKMEDIKIPLPQPQFQCAKSDPGG 399-668: Missing. | ||||||
| Isoform 4 (identifier: Q8N1M1-4) The sequence of this isoform differs from the canonical sequence as follows: 1-106: Missing. 161-178: GFMTTDERKLFNHLKSPH → ERTGMKPILPSSFEMQSF 179-668: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 668 | 668 | Bestrophin-3 | PRO_0000143121 | |||||
Regions | |||||||||
| Topological domain | 1 – 25 | 25 | Cytoplasmic Potential | ||||||
| Transmembrane | 26 – 46 | 21 | Helical; Potential | ||||||
| Topological domain | 47 – 70 | 24 | Extracellular Potential | ||||||
| Transmembrane | 71 – 91 | 21 | Helical; Potential | ||||||
| Topological domain | 92 – 178 | 87 | Cytoplasmic Potential | ||||||
| Transmembrane | 179 – 199 | 21 | Helical; Potential | ||||||
| Topological domain | 200 – 228 | 29 | Extracellular Potential | ||||||
| Intramembrane | 229 – 249 | 21 | Potential | ||||||
| Topological domain | 250 – 270 | 21 | Extracellular Potential | ||||||
| Transmembrane | 271 – 291 | 21 | Helical; Potential | ||||||
| Topological domain | 292 – 668 | 377 | Cytoplasmic Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 106 | 106 | Missing in isoform 4. | VSP_008981 | |||||
| Alternative sequence | 161 – 178 | 18 | GFMTT…LKSPH → ERTGMKPILPSSFEMQSF in isoform 4. | VSP_008982 | |||||
| Alternative sequence | 179 – 668 | 490 | Missing in isoform 4. | VSP_008983 | |||||
| Alternative sequence | 368 – 398 | 31 | LSGSD…RVKRF → KQMPKNEWKMEDIKIPLPQP QFQCAKSDPGG in isoform 1. | VSP_008977 | |||||
| Alternative sequence | 399 – 668 | 270 | Missing in isoform 1. | VSP_008978 | |||||
| Natural variant | 43 | 1 | Y → H. Corresponds to variant rs1025016 [ dbSNP | Ensembl ]. | VAR_048409 | |||||
| Natural variant | 622 | 1 | E → G. Corresponds to variant rs17106884 [ dbSNP | Ensembl ]. | VAR_048410 | |||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Three novel human VMD2-like genes are members of the evolutionary highly conserved RFP-TM family." Stoehr H., Marquardt A., Nanda I., Schmid M., Weber B.H.F. Eur. J. Hum. Genet. 10:281-284(2002) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY. |
| [2] | "Structure-function analysis of the bestrophin family of anion channels." Tsunenari T., Sun H., Williams J., Cahill H., Smallwood P., Yau K.-W., Nathans J. J. Biol. Chem. 278:41114-41125(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION. |
| [3] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Tongue. |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4). Tissue: Lymph. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF440758 mRNA. Translation: AAM76997.1. AY515706 mRNA. Translation: AAR99656.1. AK096459 mRNA. Translation: BAC04797.1. BC006440 mRNA. Translation: AAH06440.1. |
| IPI | IPI00013763. IPI00166196. IPI00168901. |
| RefSeq | NP_116124.2. NM_032735.2. |
| UniGene | Hs.280782. |
3D structure databases | |
| ProteinModelPortal | Q8N1M1. |
| ModBase | Search... |
PTM databases | |
| PhosphoSite | Q8N1M1. |
Polymorphism databases | |
| DMDM | 38503351. |
Proteomic databases | |
| PaxDb | Q8N1M1. |
| PRIDE | Q8N1M1. |
Protocols and materials databases | |
| DNASU | 144453. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000266661; ENSP00000266661; ENSG00000127325. ENST00000330891; ENSP00000332413; ENSG00000127325. ENST00000331471; ENSP00000329064; ENSG00000127325. ENST00000393365; ENSP00000377032; ENSG00000127325. ENST00000551160; ENSP00000449377; ENSG00000127325. |
| GeneID | 144453. |
| KEGG | hsa:144453. |
| UCSC | uc001svd.2. human. uc001svg.3. human. |
Organism-specific databases | |
| CTD | 144453. |
| GeneCards | GC12M070037. |
| H-InvDB | HIX0010809. |
| HGNC | HGNC:17105. BEST3. |
| HPA | HPA054582. |
| MIM | 607337. gene. |
| neXtProt | NX_Q8N1M1. |
| PharmGKB | PA162377503. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG315004. |
| HOGENOM | HOG000115678. |
| HOVERGEN | HBG080894. |
| InParanoid | Q8N1M1. |
| KO | K13880. |
| OMA | LSTIRET. |
| OrthoDB | EOG4Q84X2. |
| PhylomeDB | Q8N1M1. |
Gene expression databases | |
| ArrayExpress | Q8N1M1. |
| Bgee | Q8N1M1. |
| CleanEx | HS_BEST3. |
| Genevestigator | Q8N1M1. |
| GermOnline | ENSG00000127325. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR000615. Bestrophin. IPR021134. Bestrophin/UPF0187. [Graphical view] |
| PANTHER | PTHR10736. PTHR10736. 1 hit. |
| Pfam | PF01062. Bestrophin. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 144453. |
| NextBio | 84929. |
| SOURCE | Search... |
Entry information
| Entry name | BEST3_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q8N1M1 Secondary accession number(s): Q53YQ7 Q9BR80 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 12 Human chromosome 12: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
