Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Protein THEMIS

Gene

THEMIS

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Plays a central role in late thymocyte development by controlling both positive and negative T-cell selection. Required to sustain and/or integrate signals required for proper lineage commitment and maturation of T-cells. Regulates T-cell development through T-cell antigen receptor (TCR) signaling and in particular through the regulation of calcium influx and phosphorylation of Erk.By similarity

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Developmental protein

Keywords - Biological processi

Adaptive immunity, Immunity

Names & Taxonomyi

Protein namesi
Recommended name:
Protein THEMIS
Alternative name(s):
Thymocyte-expressed molecule involved in selection
Gene namesi
Name:THEMIS
Synonyms:C6orf190, C6orf207
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 6

Organism-specific databases

HGNCiHGNC:21569. THEMIS.

Subcellular locationi

  • Cytoplasm By similarity
  • Nucleus By similarity

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA165618330.

Polymorphism and mutation databases

BioMutaiTHEMIS.
DMDMi150421530.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 641641Protein THEMISPRO_0000252378Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei584 – 5841PhosphoserineCombined sources

Post-translational modificationi

Phosphorylated on Tyr residues quickly after TCR stimulation.By similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ8N1K5.
PeptideAtlasiQ8N1K5.
PRIDEiQ8N1K5.

PTM databases

iPTMnetiQ8N1K5.
PhosphoSiteiQ8N1K5.

Expressioni

Gene expression databases

BgeeiQ8N1K5.
CleanExiHS_C6orf190.
ExpressionAtlasiQ8N1K5. baseline and differential.
GenevisibleiQ8N1K5. HS.

Organism-specific databases

HPAiHPA031422.
HPA031425.

Interactioni

Subunit structurei

Interacts with PLCG1, ITK, GRB2, and LAT.By similarity

Binary interactionsi

WithEntry#Exp.IntActNotes
PRMT6Q96LA82EBI-2873538,EBI-912440
PTPN6P293504EBI-2873538,EBI-78260

Protein-protein interaction databases

BioGridi132289. 4 interactions.
IntActiQ8N1K5. 7 interactions.
MINTiMINT-6940582.

Structurei

3D structure databases

ProteinModelPortaliQ8N1K5.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni1 – 259259CABIT 1Add
BLAST
Regioni260 – 518259CABIT 2Add
BLAST

Sequence similaritiesi

Belongs to the themis family.Curated

Phylogenomic databases

GeneTreeiENSGT00530000063770.
InParanoidiQ8N1K5.
OMAiVANPREC.
OrthoDBiEOG74BJRN.
PhylomeDBiQ8N1K5.

Family and domain databases

InterProiIPR025946. CABIT_dom.
[Graphical view]
PfamiPF12736. CABIT. 2 hits.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8N1K5-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MALSLEEFVH SLDLRTLPRV LEIQAGIYLE GSIYEMFGNE CCFSTGEVIK
60 70 80 90 100
ITGLKVKKII AEICEQIEGC ESLQPFELPM NFPGLFKIVA DKTPYLTMEE
110 120 130 140 150
ITRTIHIGPS RLGHPCFYHQ KDIKLENLII KQGEQIMLNS VEEIDGEIMV
160 170 180 190 200
SCAVARNHQT HSFNLPLSQE GEFYECEDER IYTLKEIVEW KIPKNRTRTV
210 220 230 240 250
NLTDFSNKWD STNPFPKDFY GTLILKPVYE IQGVMKFRKD IIRILPSLDV
260 270 280 290 300
EVKDITDSYD ANWFLQLLST EDLFEMTSKE FPIVTEVIEA PEGNHLPQSI
310 320 330 340 350
LQPGKTIVIH KKYQASRILA SEIRSNFPKR HFLIPTSYKG KFKRRPREFP
360 370 380 390 400
TAYDLEIAKS EKEPLHVVAT KAFHSPHDKL SSVSVGDQFL VHQSETTEVL
410 420 430 440 450
CEGIKKVVNV LACEKILKKS YEAALLPLYM EGGFVEVIHD KKQYPISELC
460 470 480 490 500
KQFRLPFNVK VSVRDLSIEE DVLAATPGLQ LEEDITDSYL LISDFANPTE
510 520 530 540 550
CWEIPVGRLN MTVQLVSNFS RDAEPFLVRT LVEEITEEQY YMMRRYESSA
560 570 580 590 600
SHPPPRPPKH PSVEETKLTL LTLAEERTVD LPKSPKRHHV DITKKLHPNQ
610 620 630 640
AGLDSKVLIG SQNDLVDEEK ERSNRGATAI AETFKNEKHQ K
Length:641
Mass (Da):73,452
Last modified:June 26, 2007 - v3
Checksum:i30B5325242212E94
GO
Isoform 2 (identifier: Q8N1K5-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-35: Missing.

Note: No experimental confirmation available.
Show »
Length:606
Mass (Da):69,464
Checksum:i80D80EBB22A38903
GO
Isoform 3 (identifier: Q8N1K5-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-97: Missing.

Note: No experimental confirmation available.
Show »
Length:544
Mass (Da):62,568
Checksum:i3BCFA122086FFA1D
GO
Isoform 4 (identifier: Q8N1K5-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     586-586: K → KAGVQWRDLGSLQPLPPGFKQFSASASHVAGITGTPHHVQ

Note: No experimental confirmation available. Gene prediction based on EST data.
Show »
Length:680
Mass (Da):77,515
Checksum:i949C286B5CC7558F
GO

Sequence cautioni

The sequence BAC05194.1 differs from that shown.Contaminating sequence. Potential poly-A sequence.Curated
The sequence BAG52943.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence CAI13397.1 differs from that shown. Reason: Erroneous gene model prediction. Curated
The sequence CAI17111.1 differs from that shown. Reason: Erroneous gene model prediction. Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti63 – 631I → V in BAF84735 (PubMed:14702039).Curated
Sequence conflicti72 – 721S → F in BAG53994 (PubMed:14702039).Curated
Sequence conflicti220 – 2201Y → C in BAG53994 (PubMed:14702039).Curated
Sequence conflicti482 – 4821E → K in BAG53994 (PubMed:14702039).Curated
Sequence conflicti510 – 5101N → S in CAE45941 (PubMed:17974005).Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti284 – 2841V → G.
Corresponds to variant rs11968051 [ dbSNP | Ensembl ].
VAR_027846
Natural varianti630 – 6301I → V.4 Publications
Corresponds to variant rs675531 [ dbSNP | Ensembl ].
VAR_027847

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 9797Missing in isoform 3. CuratedVSP_037964Add
BLAST
Alternative sequencei1 – 3535Missing in isoform 2. 1 PublicationVSP_037965Add
BLAST
Alternative sequencei586 – 5861K → KAGVQWRDLGSLQPLPPGFK QFSASASHVAGITGTPHHVQ in isoform 4. CuratedVSP_055714

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK094863 mRNA. Translation: BAG52943.1. Different initiation.
CH471051 Genomic DNA. Translation: EAW48092.1.
BC130516 mRNA. Translation: AAI30517.1.
AK124031 mRNA. Translation: BAG53994.1.
AK128377 mRNA. Translation: BAG54669.1.
AK292046 mRNA. Translation: BAF84735.1.
AL035470 Genomic DNA. No translation available.
AL365224, AL356432 Genomic DNA. Translation: CAI17110.1.
AL365224, AL356432 Genomic DNA. Translation: CAI17111.1. Sequence problems.
AL356432, AL365224 Genomic DNA. Translation: CAI13396.1.
AL356432, AL365224 Genomic DNA. Translation: CAI13397.1. Sequence problems.
AK097903 mRNA. Translation: BAC05194.1. Sequence problems.
BX640890 mRNA. Translation: CAE45941.1.
CCDSiCCDS34534.1. [Q8N1K5-1]
CCDS55055.1. [Q8N1K5-2]
CCDS55056.1. [Q8N1K5-4]
RefSeqiNP_001010923.1. NM_001010923.2. [Q8N1K5-1]
NP_001158157.1. NM_001164685.1. [Q8N1K5-4]
NP_001158159.1. NM_001164687.1. [Q8N1K5-2]
NP_001305460.1. NM_001318531.1. [Q8N1K5-3]
XP_011534118.1. XM_011535816.1. [Q8N1K5-3]
XP_011534119.1. XM_011535817.1. [Q8N1K5-3]
XP_011544788.1. XM_011546486.1. [Q8N1K5-3]
XP_011544789.1. XM_011546487.1. [Q8N1K5-3]
UniGeneiHs.661756.

Genome annotation databases

EnsembliENST00000368248; ENSP00000357231; ENSG00000172673. [Q8N1K5-1]
ENST00000368250; ENSP00000357233; ENSG00000172673. [Q8N1K5-1]
ENST00000537166; ENSP00000439863; ENSG00000172673. [Q8N1K5-2]
ENST00000610842; ENSP00000480630; ENSG00000275122. [Q8N1K5-1]
ENST00000613862; ENSP00000480967; ENSG00000275122. [Q8N1K5-1]
ENST00000614155; ENSP00000484170; ENSG00000275122. [Q8N1K5-2]
ENST00000630369; ENSP00000487358; ENSG00000172673. [Q8N1K5-4]
GeneIDi387357.
KEGGihsa:387357.
UCSCiuc010kfb.3. human. [Q8N1K5-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK094863 mRNA. Translation: BAG52943.1. Different initiation.
CH471051 Genomic DNA. Translation: EAW48092.1.
BC130516 mRNA. Translation: AAI30517.1.
AK124031 mRNA. Translation: BAG53994.1.
AK128377 mRNA. Translation: BAG54669.1.
AK292046 mRNA. Translation: BAF84735.1.
AL035470 Genomic DNA. No translation available.
AL365224, AL356432 Genomic DNA. Translation: CAI17110.1.
AL365224, AL356432 Genomic DNA. Translation: CAI17111.1. Sequence problems.
AL356432, AL365224 Genomic DNA. Translation: CAI13396.1.
AL356432, AL365224 Genomic DNA. Translation: CAI13397.1. Sequence problems.
AK097903 mRNA. Translation: BAC05194.1. Sequence problems.
BX640890 mRNA. Translation: CAE45941.1.
CCDSiCCDS34534.1. [Q8N1K5-1]
CCDS55055.1. [Q8N1K5-2]
CCDS55056.1. [Q8N1K5-4]
RefSeqiNP_001010923.1. NM_001010923.2. [Q8N1K5-1]
NP_001158157.1. NM_001164685.1. [Q8N1K5-4]
NP_001158159.1. NM_001164687.1. [Q8N1K5-2]
NP_001305460.1. NM_001318531.1. [Q8N1K5-3]
XP_011534118.1. XM_011535816.1. [Q8N1K5-3]
XP_011534119.1. XM_011535817.1. [Q8N1K5-3]
XP_011544788.1. XM_011546486.1. [Q8N1K5-3]
XP_011544789.1. XM_011546487.1. [Q8N1K5-3]
UniGeneiHs.661756.

3D structure databases

ProteinModelPortaliQ8N1K5.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi132289. 4 interactions.
IntActiQ8N1K5. 7 interactions.
MINTiMINT-6940582.

PTM databases

iPTMnetiQ8N1K5.
PhosphoSiteiQ8N1K5.

Polymorphism and mutation databases

BioMutaiTHEMIS.
DMDMi150421530.

Proteomic databases

MaxQBiQ8N1K5.
PeptideAtlasiQ8N1K5.
PRIDEiQ8N1K5.

Protocols and materials databases

DNASUi387357.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000368248; ENSP00000357231; ENSG00000172673. [Q8N1K5-1]
ENST00000368250; ENSP00000357233; ENSG00000172673. [Q8N1K5-1]
ENST00000537166; ENSP00000439863; ENSG00000172673. [Q8N1K5-2]
ENST00000610842; ENSP00000480630; ENSG00000275122. [Q8N1K5-1]
ENST00000613862; ENSP00000480967; ENSG00000275122. [Q8N1K5-1]
ENST00000614155; ENSP00000484170; ENSG00000275122. [Q8N1K5-2]
ENST00000630369; ENSP00000487358; ENSG00000172673. [Q8N1K5-4]
GeneIDi387357.
KEGGihsa:387357.
UCSCiuc010kfb.3. human. [Q8N1K5-1]

Organism-specific databases

CTDi387357.
GeneCardsiTHEMIS.
H-InvDBHIX0006207.
HGNCiHGNC:21569. THEMIS.
HPAiHPA031422.
HPA031425.
MIMi613607. gene.
neXtProtiNX_Q8N1K5.
PharmGKBiPA165618330.
GenAtlasiSearch...

Phylogenomic databases

GeneTreeiENSGT00530000063770.
InParanoidiQ8N1K5.
OMAiVANPREC.
OrthoDBiEOG74BJRN.
PhylomeDBiQ8N1K5.

Miscellaneous databases

GeneWikiiProtein_THEMIS.
GenomeRNAii387357.
PROiQ8N1K5.
SOURCEiSearch...

Gene expression databases

BgeeiQ8N1K5.
CleanExiHS_C6orf190.
ExpressionAtlasiQ8N1K5. baseline and differential.
GenevisibleiQ8N1K5. HS.

Family and domain databases

InterProiIPR025946. CABIT_dom.
[Graphical view]
PfamiPF12736. CABIT. 2 hits.
[Graphical view]
ProtoNetiSearch...

Publicationsi

  1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2), VARIANT VAL-630.
    Tissue: Caudate nucleus, Spleen and Thymus.
  2. "The DNA sequence and analysis of human chromosome 6."
    Mungall A.J., Palmer S.A., Sims S.K., Edwards C.A., Ashurst J.L., Wilming L., Jones M.C., Horton R., Hunt S.E., Scott C.E., Gilbert J.G.R., Clamp M.E., Bethel G., Milne S., Ainscough R., Almeida J.P., Ambrose K.D., Andrews T.D.
    , Ashwell R.I.S., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beare D.M., Beasley H., Beasley O., Bird C.P., Blakey S.E., Bray-Allen S., Brook J., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Clark S.Y., Clark G., Clee C.M., Clegg S., Cobley V., Collier R.E., Collins J.E., Colman L.K., Corby N.R., Coville G.J., Culley K.M., Dhami P., Davies J., Dunn M., Earthrowl M.E., Ellington A.E., Evans K.A., Faulkner L., Francis M.D., Frankish A., Frankland J., French L., Garner P., Garnett J., Ghori M.J., Gilby L.M., Gillson C.J., Glithero R.J., Grafham D.V., Grant M., Gribble S., Griffiths C., Griffiths M.N.D., Hall R., Halls K.S., Hammond S., Harley J.L., Hart E.A., Heath P.D., Heathcott R., Holmes S.J., Howden P.J., Howe K.L., Howell G.R., Huckle E., Humphray S.J., Humphries M.D., Hunt A.R., Johnson C.M., Joy A.A., Kay M., Keenan S.J., Kimberley A.M., King A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C.R., Lloyd D.M., Loveland J.E., Lovell J., Martin S., Mashreghi-Mohammadi M., Maslen G.L., Matthews L., McCann O.T., McLaren S.J., McLay K., McMurray A., Moore M.J.F., Mullikin J.C., Niblett D., Nickerson T., Novik K.L., Oliver K., Overton-Larty E.K., Parker A., Patel R., Pearce A.V., Peck A.I., Phillimore B.J.C.T., Phillips S., Plumb R.W., Porter K.M., Ramsey Y., Ranby S.A., Rice C.M., Ross M.T., Searle S.M., Sehra H.K., Sheridan E., Skuce C.D., Smith S., Smith M., Spraggon L., Squares S.L., Steward C.A., Sycamore N., Tamlyn-Hall G., Tester J., Theaker A.J., Thomas D.W., Thorpe A., Tracey A., Tromans A., Tubby B., Wall M., Wallis J.M., West A.P., White S.S., Whitehead S.L., Whittaker H., Wild A., Willey D.J., Wilmer T.E., Wood J.M., Wray P.W., Wyatt J.C., Young L., Younger R.M., Bentley D.R., Coulson A., Durbin R.M., Hubbard T., Sulston J.E., Dunham I., Rogers J., Beck S.
    Nature 425:805-811(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANT VAL-630.
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT VAL-630.
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 430-641 (ISOFORM 1), VARIANT VAL-630.
    Tissue: Small intestine.
  6. "Robust phosphoproteomic profiling of tyrosine phosphorylation sites from human T cells using immobilized metal affinity chromatography and tandem mass spectrometry."
    Brill L.M., Salomon A.R., Ficarro S.B., Mukherji M., Stettler-Gill M., Peters E.C.
    Anal. Chem. 76:2763-2772(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-584, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Leukemic T-cell.
  7. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
    Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
    Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-584, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Leukemic T-cell.

Entry informationi

Entry nameiTHMS1_HUMAN
AccessioniPrimary (citable) accession number: Q8N1K5
Secondary accession number(s): A1L4F0
, A8K7N1, B3KT31, B3KW32, B3KY07, F5H1J9, Q5T3C4, Q5T3C5, Q6MZT7
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 17, 2006
Last sequence update: June 26, 2007
Last modified: July 6, 2016
This is version 109 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 6
    Human chromosome 6: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.