Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Protein THEMIS

Gene

THEMIS

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Plays a central role in late thymocyte development by controlling both positive and negative T-cell selection. Required to sustain and/or integrate signals required for proper lineage commitment and maturation of T-cells. Regulates T-cell development through T-cell antigen receptor (TCR) signaling and in particular through the regulation of calcium influx and phosphorylation of Erk.By similarity

GO - Biological processi

Keywordsi

Molecular functionDevelopmental protein
Biological processAdaptive immunity, Immunity

Names & Taxonomyi

Protein namesi
Recommended name:
Protein THEMIS
Alternative name(s):
Thymocyte-expressed molecule involved in selection
Gene namesi
Name:THEMIS
Synonyms:C6orf190, C6orf207
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 6

Organism-specific databases

EuPathDBiHostDB:ENSG00000172673.10
HGNCiHGNC:21569 THEMIS
MIMi613607 gene
neXtProtiNX_Q8N1K5

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Organism-specific databases

DisGeNETi387357
OpenTargetsiENSG00000172673
PharmGKBiPA165618330

Polymorphism and mutation databases

BioMutaiTHEMIS
DMDMi150421530

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002523781 – 641Protein THEMISAdd BLAST641

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei584PhosphoserineCombined sources1

Post-translational modificationi

Phosphorylated on Tyr residues quickly after TCR stimulation.By similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ8N1K5
PeptideAtlasiQ8N1K5
PRIDEiQ8N1K5
ProteomicsDBi71609
71610 [Q8N1K5-2]
71611 [Q8N1K5-3]

PTM databases

iPTMnetiQ8N1K5
PhosphoSitePlusiQ8N1K5

Expressioni

Gene expression databases

BgeeiENSG00000172673
CleanExiHS_C6orf190
ExpressionAtlasiQ8N1K5 baseline and differential
GenevisibleiQ8N1K5 HS

Organism-specific databases

HPAiHPA031422
HPA031425

Interactioni

Subunit structurei

Interacts with PLCG1, ITK, GRB2, and LAT.By similarity

Binary interactionsi

Show more details

Protein-protein interaction databases

BioGridi132289, 4 interactors
IntActiQ8N1K5, 12 interactors
MINTiQ8N1K5

Structurei

3D structure databases

ProteinModelPortaliQ8N1K5
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni1 – 259CABIT 1Add BLAST259
Regioni260 – 518CABIT 2Add BLAST259

Sequence similaritiesi

Belongs to the themis family.Curated

Phylogenomic databases

GeneTreeiENSGT00530000063770
InParanoidiQ8N1K5
OMAiQGVMKFR
OrthoDBiEOG091G02V6
PhylomeDBiQ8N1K5

Family and domain databases

InterProiView protein in InterPro
IPR025946 CABIT_dom
PfamiView protein in Pfam
PF12736 CABIT, 2 hits

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8N1K5-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MALSLEEFVH SLDLRTLPRV LEIQAGIYLE GSIYEMFGNE CCFSTGEVIK
60 70 80 90 100
ITGLKVKKII AEICEQIEGC ESLQPFELPM NFPGLFKIVA DKTPYLTMEE
110 120 130 140 150
ITRTIHIGPS RLGHPCFYHQ KDIKLENLII KQGEQIMLNS VEEIDGEIMV
160 170 180 190 200
SCAVARNHQT HSFNLPLSQE GEFYECEDER IYTLKEIVEW KIPKNRTRTV
210 220 230 240 250
NLTDFSNKWD STNPFPKDFY GTLILKPVYE IQGVMKFRKD IIRILPSLDV
260 270 280 290 300
EVKDITDSYD ANWFLQLLST EDLFEMTSKE FPIVTEVIEA PEGNHLPQSI
310 320 330 340 350
LQPGKTIVIH KKYQASRILA SEIRSNFPKR HFLIPTSYKG KFKRRPREFP
360 370 380 390 400
TAYDLEIAKS EKEPLHVVAT KAFHSPHDKL SSVSVGDQFL VHQSETTEVL
410 420 430 440 450
CEGIKKVVNV LACEKILKKS YEAALLPLYM EGGFVEVIHD KKQYPISELC
460 470 480 490 500
KQFRLPFNVK VSVRDLSIEE DVLAATPGLQ LEEDITDSYL LISDFANPTE
510 520 530 540 550
CWEIPVGRLN MTVQLVSNFS RDAEPFLVRT LVEEITEEQY YMMRRYESSA
560 570 580 590 600
SHPPPRPPKH PSVEETKLTL LTLAEERTVD LPKSPKRHHV DITKKLHPNQ
610 620 630 640
AGLDSKVLIG SQNDLVDEEK ERSNRGATAI AETFKNEKHQ K
Length:641
Mass (Da):73,452
Last modified:June 26, 2007 - v3
Checksum:i30B5325242212E94
GO
Isoform 2 (identifier: Q8N1K5-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-35: Missing.

Note: No experimental confirmation available.
Show »
Length:606
Mass (Da):69,464
Checksum:i80D80EBB22A38903
GO
Isoform 3 (identifier: Q8N1K5-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-97: Missing.

Note: No experimental confirmation available.
Show »
Length:544
Mass (Da):62,568
Checksum:i3BCFA122086FFA1D
GO
Isoform 4 (identifier: Q8N1K5-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     586-586: K → KAGVQWRDLGSLQPLPPGFKQFSASASHVAGITGTPHHVQ

Note: No experimental confirmation available. Gene prediction based on EST data.
Show »
Length:680
Mass (Da):77,515
Checksum:i949C286B5CC7558F
GO

Sequence cautioni

The sequence BAC05194 differs from that shown. Contaminating sequence. Potential poly-A sequence.Curated
The sequence BAG52943 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence CAI13397 differs from that shown. Reason: Erroneous gene model prediction.Curated
The sequence CAI17111 differs from that shown. Reason: Erroneous gene model prediction.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti63I → V in BAF84735 (PubMed:14702039).Curated1
Sequence conflicti72S → F in BAG53994 (PubMed:14702039).Curated1
Sequence conflicti220Y → C in BAG53994 (PubMed:14702039).Curated1
Sequence conflicti482E → K in BAG53994 (PubMed:14702039).Curated1
Sequence conflicti510N → S in CAE45941 (PubMed:17974005).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_027846284V → G. Corresponds to variant dbSNP:rs11968051Ensembl.1
Natural variantiVAR_027847630I → V4 PublicationsCorresponds to variant dbSNP:rs675531Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0379641 – 97Missing in isoform 3. CuratedAdd BLAST97
Alternative sequenceiVSP_0379651 – 35Missing in isoform 2. 1 PublicationAdd BLAST35
Alternative sequenceiVSP_055714586K → KAGVQWRDLGSLQPLPPGFK QFSASASHVAGITGTPHHVQ in isoform 4. Curated1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK094863 mRNA Translation: BAG52943.1 Different initiation.
CH471051 Genomic DNA Translation: EAW48092.1
BC130516 mRNA Translation: AAI30517.1
AK124031 mRNA Translation: BAG53994.1
AK128377 mRNA Translation: BAG54669.1
AK292046 mRNA Translation: BAF84735.1
AL035470 Genomic DNA No translation available.
AL365224, AL356432 Genomic DNA Translation: CAI17110.1
AL365224, AL356432 Genomic DNA Translation: CAI17111.1 Sequence problems.
AL356432, AL365224 Genomic DNA Translation: CAI13396.1
AL356432, AL365224 Genomic DNA Translation: CAI13397.1 Sequence problems.
AK097903 mRNA Translation: BAC05194.1 Sequence problems.
BX640890 mRNA Translation: CAE45941.1
CCDSiCCDS34534.1 [Q8N1K5-1]
CCDS55055.1 [Q8N1K5-2]
CCDS55056.1 [Q8N1K5-4]
RefSeqiNP_001010923.1, NM_001010923.2 [Q8N1K5-1]
NP_001158157.1, NM_001164685.1 [Q8N1K5-4]
NP_001158159.1, NM_001164687.1 [Q8N1K5-2]
NP_001305460.1, NM_001318531.1 [Q8N1K5-3]
XP_011534118.1, XM_011535816.1 [Q8N1K5-3]
UniGeneiHs.661756

Genome annotation databases

EnsembliENST00000368248; ENSP00000357231; ENSG00000172673 [Q8N1K5-1]
ENST00000368250; ENSP00000357233; ENSG00000172673 [Q8N1K5-1]
ENST00000537166; ENSP00000439863; ENSG00000172673 [Q8N1K5-2]
ENST00000610842; ENSP00000480630; ENSG00000275122 [Q8N1K5-1]
ENST00000613862; ENSP00000480967; ENSG00000275122 [Q8N1K5-1]
ENST00000614155; ENSP00000484170; ENSG00000275122 [Q8N1K5-2]
ENST00000630369; ENSP00000487358; ENSG00000172673 [Q8N1K5-4]
GeneIDi387357
KEGGihsa:387357
UCSCiuc010kfb.3 human [Q8N1K5-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiTHMS1_HUMAN
AccessioniPrimary (citable) accession number: Q8N1K5
Secondary accession number(s): A1L4F0
, A8K7N1, B3KT31, B3KW32, B3KY07, F5H1J9, Q5T3C4, Q5T3C5, Q6MZT7
Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 17, 2006
Last sequence update: June 26, 2007
Last modified: June 20, 2018
This is version 120 of the entry and version 3 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health