Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Serine/threonine-protein kinase 11-interacting protein

Gene

STK11IP

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

May regulate STK11/LKB1 function by controlling its subcellular localization.1 Publication

GO - Molecular functioni

  • protein kinase binding Source: UniProtKB

GO - Biological processi

  • protein localization Source: UniProtKB
Complete GO annotation...

Names & Taxonomyi

Protein namesi
Recommended name:
Serine/threonine-protein kinase 11-interacting protein
Alternative name(s):
LKB1-interacting protein 1
Gene namesi
Name:STK11IP
Synonyms:KIAA1898, LIP1, LKB1IP, STK11IP1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 2

Organism-specific databases

HGNCiHGNC:19184. STK11IP.

Subcellular locationi

  • Cytoplasm 1 Publication

  • Note: Some cells show granular or punctuate expression. Colocalizes with STK11/LKB1 and SMAD4 in granular or punctuate structures.

GO - Cellular componenti

  • cytoplasm Source: UniProtKB
  • intracellular membrane-bounded organelle Source: HPA
  • lysosomal membrane Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA38822.

Polymorphism and mutation databases

BioMutaiSTK11IP.
DMDMi296452972.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 10991099Serine/threonine-protein kinase 11-interacting proteinPRO_0000317462Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei398 – 3981PhosphoserineCombined sources
Modified residuei400 – 4001PhosphoserineCombined sources
Modified residuei403 – 4031PhosphoserineCombined sources
Modified residuei481 – 4811PhosphoserineCombined sources
Modified residuei610 – 6101PhosphoserineCombined sources
Modified residuei772 – 7721PhosphoserineCombined sources
Modified residuei784 – 7841PhosphoserineCombined sources
Modified residuei788 – 7881PhosphoserineCombined sources

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ8N1F8.
MaxQBiQ8N1F8.
PaxDbiQ8N1F8.
PeptideAtlasiQ8N1F8.
PRIDEiQ8N1F8.

PTM databases

iPTMnetiQ8N1F8.
PhosphoSiteiQ8N1F8.

Expressioni

Gene expression databases

BgeeiQ8N1F8.
CleanExiHS_STK11IP.
ExpressionAtlasiQ8N1F8. baseline and differential.
GenevisibleiQ8N1F8. HS.

Organism-specific databases

HPAiHPA036837.
HPA036838.
HPA053192.

Interactioni

Subunit structurei

Found in a ternary complex composed of STK11/LKB1, STK11IP and SMAD4. Interacts with STK11/LKB1 and SMAD4.1 Publication

GO - Molecular functioni

  • protein kinase binding Source: UniProtKB

Protein-protein interaction databases

BioGridi125352. 17 interactions.
IntActiQ8N1F8. 7 interactions.
STRINGi9606.ENSP00000295641.

Structurei

3D structure databases

ProteinModelPortaliQ8N1F8.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Repeati120 – 14122LRR 1Add
BLAST
Repeati143 – 16321LRR 2Add
BLAST
Repeati175 – 19622LRR 3Add
BLAST
Repeati198 – 22023LRR 4Add
BLAST
Repeati221 – 24222LRR 5Add
BLAST
Repeati244 – 26522LRR 6Add
BLAST
Repeati266 – 28722LRR 7Add
BLAST
Repeati291 – 31222LRR 8Add
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi485 – 604120Glu-richAdd
BLAST

Sequence similaritiesi

Belongs to the STK11IP family.Curated
Contains 8 LRR (leucine-rich) repeats.Curated

Keywords - Domaini

Leucine-rich repeat, Repeat

Phylogenomic databases

eggNOGiKOG1859. Eukaryota.
ENOG410XRFD. LUCA.
HOGENOMiHOG000070454.
HOVERGENiHBG108429.
InParanoidiQ8N1F8.
PhylomeDBiQ8N1F8.
TreeFamiTF326448.

Family and domain databases

Gene3Di3.80.10.10. 2 hits.
InterProiIPR032675. L_dom-like.
IPR001611. Leu-rich_rpt.
IPR031782. LIP1_N.
[Graphical view]
PfamiPF15904. LIP1. 1 hit.
[Graphical view]
PROSITEiPS51450. LRR. 7 hits.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8N1F8-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MFGSAPQRPV AMTTAQRDSL LWKLAGLLRE SGDVVLSGCS TLSLLTPTLQ
60 70 80 90 100
QLNHVFELHL GPWGPGQTGF VALPSHPADS PVILQLQFLF DVLQKTLSLK
110 120 130 140 150
LVHVAGPGPT GPIKIFPFKS LRHLELRGVP LHCLHGLRGI YSQLETLICS
160 170 180 190 200
RSLQALEELL SACGGDFCSA LPWLALLSAN FSYNALTALD SSLRLLSALR
210 220 230 240 250
FLNLSHNQVQ DCQGFLMDLC ELHHLDISYN RLHLVPRMGP SGAALGVLIL
260 270 280 290 300
RGNELRSLHG LEQLRNLRHL DLAYNLLEGH RELSPLWLLA ELRKLYLEGN
310 320 330 340 350
PLWFHPEHRA ATAQYLSPRA RDAATGFLLD GKVLSLTDFQ THTSLGLSPM
360 370 380 390 400
GPPLPWPVGS TPETSGGPDL SDSLSSGGVV TQPLLHKVKS RVRVRRASIS
410 420 430 440 450
EPSDTDPEPR TLNPSPAGWF VQQHPELELM SSFRERFGRN WLQYRSHLEP
460 470 480 490 500
SGNPLPATPT TSAPSAPPAS SQGPDTAPRP SPPQEEARGP QESPQKMSEE
510 520 530 540 550
VRAEPQEEEE EKEGKEEKEE GEMVEQGEEE AGEEEEEEQD QKEVEAELCR
560 570 580 590 600
PLLVCPLEGP EGVRGRECFL RVTSAHLFEV ELQAARTLER LELQSLEAAE
610 620 630 640 650
IEPEAQAQRS PRPTGSDLLP GAPILSLRFS YICPDRQLRR YLVLEPDAHA
660 670 680 690 700
AVQELLAVLT PVTNVAREQL GEARDLLLGR FQCLRCGHEF KPEEPRMGLD
710 720 730 740 750
SEEGWRPLFQ KTESPAVCPN CGSDHVVLLA VSRGTPNRER KQGEQSLAPS
760 770 780 790 800
PSASPVCHPP GHGDHLDRAK NSPPQAPSTR DHGSWSLSPP PERCGLRSVD
810 820 830 840 850
HRLRLFLDVE VFSDAQEEFQ CCLKVPVALA GHTGEFMCLV VVSDRRLYLL
860 870 880 890 900
KVTGEMREPP ASWLQLTLAV PLQDLSGIEL GLAGQSLRLE WAAGAGRCVL
910 920 930 940 950
LPRDARHCRA FLEELLDVLQ SLPPAWRNCV SATEEEVTPQ HRLWPLLEKD
960 970 980 990 1000
SSLEARQFFY LRAFLVEGPS TCLVSLLLTP STLFLLDEDA AGSPAEPSPP
1010 1020 1030 1040 1050
AASGEASEKV PPSGPGPAVR VREQQPLSSL SSVLLYRSAP EDLRLLFYDE
1060 1070 1080 1090
VSRLESFWAL RVVCQEQLTA LLAWIREPWE ELFSIGLRTV IQEALALDR
Length:1,099
Mass (Da):121,401
Last modified:May 18, 2010 - v3
Checksum:iAEFCCB4ADA84FD74
GO
Isoform 2 (identifier: Q8N1F8-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     713-747: ESPAVCPNCGSDHVVLLAVSRGTPNRERKQGEQSL → GTSPALDLSAHTPPLFQGKWLCVGECEGGALGRRG
     748-1099: Missing.

Show »
Length:747
Mass (Da):82,394
Checksum:i9667147C2F497E78
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti348 – 3481S → N in AAL49726 (PubMed:11741830).Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti393 – 3931R → H.1 Publication
Corresponds to variant rs17855575 [ dbSNP | Ensembl ].
VAR_038529
Natural varianti410 – 4101R → G.1 Publication
Corresponds to variant rs17855576 [ dbSNP | Ensembl ].
VAR_038530
Natural varianti563 – 5631V → I.2 Publications
Corresponds to variant rs673951 [ dbSNP | Ensembl ].
VAR_038531
Natural varianti752 – 7521S → F.4 Publications
Corresponds to variant rs627530 [ dbSNP | Ensembl ].
VAR_038532
Natural varianti1085 – 10851I → V.1 Publication
Corresponds to variant rs17853279 [ dbSNP | Ensembl ].
VAR_038533

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei713 – 74735ESPAV…GEQSL → GTSPALDLSAHTPPLFQGKW LCVGECEGGALGRRG in isoform 2. 1 PublicationVSP_030969Add
BLAST
Alternative sequencei748 – 1099352Missing in isoform 2. 1 PublicationVSP_030970Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF450267 mRNA. Translation: AAL49726.1.
AC009955 Genomic DNA. No translation available.
BC014114 mRNA. Translation: AAH14114.2.
BC034051 mRNA. Translation: AAH34051.1.
AK091963 mRNA. No translation available.
AB067485 mRNA. Translation: BAB67791.1.
RefSeqiNP_443134.3. NM_052902.3.
UniGeneiHs.22410.

Genome annotation databases

EnsembliENST00000295641; ENSP00000295641; ENSG00000144589.
GeneIDi114790.
KEGGihsa:114790.
UCSCiuc002vml.3. human. [Q8N1F8-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF450267 mRNA. Translation: AAL49726.1.
AC009955 Genomic DNA. No translation available.
BC014114 mRNA. Translation: AAH14114.2.
BC034051 mRNA. Translation: AAH34051.1.
AK091963 mRNA. No translation available.
AB067485 mRNA. Translation: BAB67791.1.
RefSeqiNP_443134.3. NM_052902.3.
UniGeneiHs.22410.

3D structure databases

ProteinModelPortaliQ8N1F8.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi125352. 17 interactions.
IntActiQ8N1F8. 7 interactions.
STRINGi9606.ENSP00000295641.

PTM databases

iPTMnetiQ8N1F8.
PhosphoSiteiQ8N1F8.

Polymorphism and mutation databases

BioMutaiSTK11IP.
DMDMi296452972.

Proteomic databases

EPDiQ8N1F8.
MaxQBiQ8N1F8.
PaxDbiQ8N1F8.
PeptideAtlasiQ8N1F8.
PRIDEiQ8N1F8.

Protocols and materials databases

DNASUi114790.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000295641; ENSP00000295641; ENSG00000144589.
GeneIDi114790.
KEGGihsa:114790.
UCSCiuc002vml.3. human. [Q8N1F8-1]

Organism-specific databases

CTDi114790.
GeneCardsiSTK11IP.
H-InvDBHIX0002872.
HGNCiHGNC:19184. STK11IP.
HPAiHPA036837.
HPA036838.
HPA053192.
MIMi607172. gene.
neXtProtiNX_Q8N1F8.
PharmGKBiPA38822.
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1859. Eukaryota.
ENOG410XRFD. LUCA.
HOGENOMiHOG000070454.
HOVERGENiHBG108429.
InParanoidiQ8N1F8.
PhylomeDBiQ8N1F8.
TreeFamiTF326448.

Miscellaneous databases

GenomeRNAii114790.
PROiQ8N1F8.
SOURCEiSearch...

Gene expression databases

BgeeiQ8N1F8.
CleanExiHS_STK11IP.
ExpressionAtlasiQ8N1F8. baseline and differential.
GenevisibleiQ8N1F8. HS.

Family and domain databases

Gene3Di3.80.10.10. 2 hits.
InterProiIPR032675. L_dom-like.
IPR001611. Leu-rich_rpt.
IPR031782. LIP1_N.
[Graphical view]
PfamiPF15904. LIP1. 1 hit.
[Graphical view]
PROSITEiPS51450. LRR. 7 hits.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "LIP1, a cytoplasmic protein functionally linked to the Peutz-Jeghers syndrome kinase LKB1."
    Smith D.P., Rayter S.I., Niederlander C., Spicer J., Jones C.M., Ashworth A.
    Hum. Mol. Genet. 10:2869-2877(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, IDENTIFICATION IN A TERNARY COMPLEX COMPOSED OF STK11/LKB1 AND SMAD4, INTERACTION WITH STK11/LKB1 AND SMAD4, PHOSPHORYLATION, SUBCELLULAR LOCATION, VARIANT PHE-752.
  2. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
    Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
    , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
    Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANTS HIS-393; GLY-410; ILE-563; PHE-752 AND VAL-1085.
    Tissue: Brain and Carcinoma.
  4. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 19-1099 (ISOFORM 2), VARIANT PHE-752.
    Tissue: Kidney.
  5. "Prediction of the coding sequences of unidentified human genes. XXI. The complete sequences of 60 new cDNA clones from brain which code for large proteins."
    Nagase T., Kikuno R., Ohara O.
    DNA Res. 8:179-187(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 299-1099 (ISOFORM 1), VARIANT PHE-752.
    Tissue: Brain.
  6. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-398; SER-400; SER-403 AND SER-772, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  7. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  8. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
    Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
    Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-398, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Leukemic T-cell.
  9. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
    Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
    Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  10. "Toward a comprehensive characterization of a human cancer cell phosphoproteome."
    Zhou H., Di Palma S., Preisinger C., Peng M., Polat A.N., Heck A.J., Mohammed S.
    J. Proteome Res. 12:260-271(2013) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-398; SER-610; SER-772; SER-784 AND SER-788, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma and Erythroleukemia.
  11. "An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome."
    Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D., Wang L., Ye M., Zou H.
    J. Proteomics 96:253-262(2014) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-481 AND SER-772, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Liver.
  12. "Search for the second Peutz-Jeghers syndrome locus: exclusion of the STK13, PRKCG, KLK10, and PSCD2 genes on chromosome 19 and the STK11IP gene on chromosome 2."
    Buchet-Poyau K., Mehenni H., Radhakrishna U., Antonarakis S.E.
    Cytogenet. Genome Res. 97:171-178(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: VARIANT ILE-563.

Entry informationi

Entry nameiS11IP_HUMAN
AccessioniPrimary (citable) accession number: Q8N1F8
Secondary accession number(s): Q8NAW9
, Q8WXE4, Q96CN3, Q96PY9
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 5, 2008
Last sequence update: May 18, 2010
Last modified: July 6, 2016
This is version 111 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Miscellaneous

This gene contains a polymorphic substitution resulting in a variant amino acid from Met-1 to Arg-1 compared to the official human genome. However, this variant sequence is in agreement with EST and mRNA sequences.

Caution

It is uncertain whether Met-1 or Met-12 is the initiator.Curated

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.