Reviewed,
UniProtKB/Swiss-Prot Q8N187 (AL2S8_HUMAN)
Last modified
December 15, 2009.
Version 57.
History...
Clusters with 100%,
90%,
50% identity |
Documents (2) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin · Protein attributes · General annotation (Comments) · Ontologies · Alternative products · Sequence annotation (Features) · Sequences · References · Cross-references · Entry information · Relevant documents
Names and origin
| Protein names | Recommended name: Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 8 protein Alternative name(s): Calcium-response factor Short name=CaRF Testis development protein NYD-SP24 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Complete proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 725 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at transcript level. |
General annotation (Comments)
| Function | May be a transcription factor By similarity. |
| Subcellular location | Nucleus Potential. |
| Sequence caution | The sequence BAB69018.1 differs from that shown. Reason: Frameshift at position 715. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Nucleus |
| Coding sequence diversity | Alternative splicing |
| Technical term | Complete proteome |
| Gene Ontology (GO) | |
| None. [Check GOA] | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q8N187-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q8N187-2) The sequence of this isoform differs from the canonical sequence as follows: 1-102: Missing. 279-309: SRAVVMECQYGPRRKGFQLKKVSEQESRSCQ → TFLKNYFKRFSSSHSPLSKCDFPKVITFLFW 310-725: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 725 | 725 | Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 8 protein | PRO_0000076172 | |||||
Natural variations | |||||||||
| Alternative sequence | 1 – 102 | 102 | Missing in isoform 2. | VSP_016785 | |||||
| Alternative sequence | 279 – 309 | 31 | SRAVV…SRSCQ → TFLKNYFKRFSSSHSPLSKC DFPKVITFLFW in isoform 2. | VSP_016786 | |||||
| Alternative sequence | 310 – 725 | 416 | Missing in isoform 2. | VSP_016787 | |||||
Experimental info | |||||||||
| Sequence conflict | 238 | 1 | K → E Ref.2 | ||||||
| Sequence conflict | 238 | 1 | K → E Ref.7 | ||||||
| Sequence conflict | 300 – 301 | 2 | VS → SQ Ref.7 | ||||||
| Sequence conflict | 465 | 1 | F → L in AAH33777. Ref.5 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "A gene encoding a putative GTPase regulator is mutated in familial amyotrophic lateral sclerosis 2." Hadano S., Hand C.K., Osuga H., Yanagisawa Y., Otomo A., Devon R.S., Miyamoto N., Showguchi-Miyata J., Okada Y., Singaraja R., Figlewicz D.A., Kwiatkowski T., Hosler B.A., Sagie T., Skaug J., Nasir J., Brown R.H. Jr., Scherer S.W. Ikeda J.-E.Nat. Genet. 29:166-173(2001) [PubMed: 11586298] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2). |
| [2] | "NYD-SP24: cloning a novel gene related to testis development from human testis." Sha J.H. Submitted (AUG-2001) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Testis. |
| [3] | "A calcium-responsive transcription factor, CaRF, that regulates neuronal activity-dependent expression of BDNF." Tao X., West A.E., Chen W.G., Corfas G., Greenberg M.E. Neuron 33:383-395(2002) [PubMed: 11832226] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [4] | "Generation and annotation of the DNA sequences of human chromosomes 2 and 4." Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H. Wilson R.K.Nature 434:724-731(2005) [PubMed: 15815621] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Testis. |
| [6] | "The full-ORF clone resource of the German cDNA consortium." Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I. BMC Genomics 8:399-399(2007) [PubMed: 17974005] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-278 (ISOFORM 1). Tissue: Lymph node. |
| [7] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 29-301 (ISOFORM 1). Tissue: Colon. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| AB053309 mRNA. Translation: BAB69018.1. Frameshift. AB053310 mRNA. Translation: BAB69019.1. AY032876 mRNA. Translation: AAK66819.2. AF454946 mRNA. Translation: AAL62330.1. AC010900 Genomic DNA. Translation: AAY24288.1. BC033777 mRNA. Translation: AAH33777.1. AL834188 mRNA. Translation: CAD38882.2. AK025232 mRNA. Translation: BAB15088.1. Different initiation. | |
| IPI | IPI00295701. IPI00658105. |
| RefSeq | NP_001098056.1. NP_079020.13. |
| UniGene | Hs.444982 |
3D structure databases | |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q8N187. 1 interaction. |
| STRING | Q8N187. |
PTM databases | |
| PhosphoSite | Q8N187. |
Proteomic databases | |
| PRIDE | Q8N187. |
Genome annotation databases | |
| Ensembl | ENST00000320443; ENSP00000316224; ENSG00000138380; Homo sapiens. [Genome view] ENST00000402905; ENSP00000384006; ENSG00000138380; Homo sapiens. [Genome view] ENST00000438828; ENSP00000414644; ENSG00000138380; Homo sapiens. [Genome view] |
| GeneID | 79800. |
| KEGG | hsa:79800. |
| UCSC | uc002uzm.2. human. uc002uzo.2. human. |
Organism-specific databases | |
| CTD | 79800. |
| GeneCards | GC02P203485. |
| H-InvDB | HIX0002756. |
| HGNC | HGNC:14435. ALS2CR8. |
| MIM | 607586. gene. |
| PharmGKB | PA24748. |
| GenAtlas | Search... |
Phylogenomic databases | |
| HOVERGEN | Q8N187. |
| InParanoid | Q8N187. |
| OMA | QLQPRFT. |
| OrthoDB | EOG94J548. |
Gene expression databases | |
| ArrayExpress | Q8N187. |
| Bgee | Q8N187. |
| CleanEx | HS_ALS2CR8. |
| Genevestigator | Q8N187. |
| GermOnline | ENSG00000138380. Homo sapiens. |
Family and domain databases | |
| ProtoNet | Search... |
Other Resources | |
| NextBio | 69356. |
| SOURCE | Search... |
Entry information
| Entry name | AL2S8_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q8N187 Secondary accession number(s): Q8ND29 Q9H712 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 2 Human chromosome 2: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |

Clusters with


