Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q8N187

- CARTF_HUMAN

UniProt

Q8N187 - CARTF_HUMAN

Protein

Calcium-responsive transcription factor

Gene

CARF

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 4 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 91 (01 Oct 2014)
      Sequence version 2 (10 Jan 2006)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Acts as a transcriptional activator that mediates the calcium- and neuron-selective induction of BDNF exon III transcription. Binds to the consensus calcium-response element CaRE1 5'-CTATTTCGAG-3' sequence.2 Publications

    GO - Molecular functioni

    1. DNA binding Source: UniProtKB
    2. sequence-specific DNA binding transcription factor activity Source: UniProtKB

    GO - Biological processi

    1. cellular response to calcium ion Source: UniProtKB
    2. cellular response to potassium ion Source: UniProtKB
    3. positive regulation of transcription from RNA polymerase II promoter in response to calcium ion Source: UniProtKB
    4. transcription, DNA-templated Source: UniProtKB-KW

    Keywords - Molecular functioni

    Activator

    Keywords - Biological processi

    Transcription, Transcription regulation

    Keywords - Ligandi

    DNA-binding

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Calcium-responsive transcription factor
    Alternative name(s):
    Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 8 protein
    Calcium-response factor
    Short name:
    CaRF
    Testis development protein NYD-SP24
    Gene namesi
    Name:CARF
    Synonyms:ALS2CR8
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 2

    Organism-specific databases

    HGNCiHGNC:14435. CARF.

    Subcellular locationi

    Nucleus By similarity

    GO - Cellular componenti

    1. nucleolus Source: Ensembl
    2. nucleoplasm Source: Ensembl
    3. nucleus Source: UniProtKB

    Keywords - Cellular componenti

    Nucleus

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA24748.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 725725Calcium-responsive transcription factorPRO_0000076172Add
    BLAST

    Proteomic databases

    PaxDbiQ8N187.
    PRIDEiQ8N187.

    PTM databases

    PhosphoSiteiQ8N187.

    Expressioni

    Gene expression databases

    ArrayExpressiQ8N187.
    BgeeiQ8N187.
    CleanExiHS_ALS2CR8.
    GenevestigatoriQ8N187.

    Organism-specific databases

    HPAiHPA034557.

    Interactioni

    Protein-protein interaction databases

    BioGridi122897. 3 interactions.
    IntActiQ8N187. 3 interactions.
    MINTiMINT-1472416.
    STRINGi9606.ENSP00000316224.

    Structurei

    3D structure databases

    ProteinModelPortaliQ8N187.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domaini

    The N-terminus is necessary for DNA-binding. The C-terminus is necessary for transcriptional activation (PubMed:11832226).1 Publication

    Phylogenomic databases

    eggNOGiNOG45356.
    HOVERGENiHBG080829.
    InParanoidiQ8N187.
    OMAiQLQPRFT.
    OrthoDBiEOG761BTC.
    PhylomeDBiQ8N187.
    TreeFamiTF333279.

    Family and domain databases

    InterProiIPR029309. CaRF.
    [Graphical view]
    PfamiPF15299. ALS2CR8. 1 hit.
    [Graphical view]

    Sequences (3)i

    Sequence statusi: Complete.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q8N187-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MEQSNDSLRV NHNDGEESKT SAQVFEHLIC MDSRDSSFGQ NDSPTVLPIT    50
    TREANNSLIS QNIPGPLTQT QTLSAEQFHL VDQNGQAIQY ELQSLGESNA 100
    QMMIVASPTE NGQVLRVIPP TQTGMAQVII PQGQLVDVNS PRDVPEEKPS 150
    NRNLPTVRVD TLADNTSNYI LHPQTSFPLP KKSVTGMLEE PLLGPLQPLS 200
    SNTPIWACRL RSCEKIGDSY RGYCVSETEL ESVLTFHKQQ TQSVWGTRQS 250
    PSPAKPATRL MWKSQYVPYD GIPFVNAGSR AVVMECQYGP RRKGFQLKKV 300
    SEQESRSCQL YKATCPARIY IKKVQKFPEY RVPTDPKIDK KIIRMEQEKA 350
    FNMLKKNLVD AGGVLRWYVQ LPTQQAHQYH ELETPCLTLS PSPFPVSSLE 400
    EEETAVRDEN CALPSRLHPQ VAHKIQELVS QGIEQVYAVR KQLRKFVERE 450
    LFKPDEVPER HNLSFFPTVN DIKNHIHEVQ KSLRNGDTVY NSEIIPATLQ 500
    WTTDSGNILK ETMTVTFAEG NSPGESITTK VETNQTRGSL SPEPTHLLSS 550
    LSSFQPKIFT QLQGLQLQPR YTSPDESPAV VSVNNQPSSS PSGLLDTIGS 600
    AVMNNNSLLL GQSHSLQRDT CLTQNNSTAS TMGNLPEPDQ NLVAMDELVE 650
    VGDVEDTGNL EGTVHRILLG DVQTIPIQII DNHSALIEEN PESTISVSQV 700
    KQEPKEPALS MEAKKTVDYK KLSAT 725
    Length:725
    Mass (Da):80,698
    Last modified:January 10, 2006 - v2
    Checksum:i871D8874DF8D1384
    GO
    Isoform 2 (identifier: Q8N187-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-102: Missing.
         279-309: SRAVVMECQYGPRRKGFQLKKVSEQESRSCQ → TFLKNYFKRFSSSHSPLSKCDFPKVITFLFW
         310-725: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:207
    Mass (Da):23,212
    Checksum:iB63FE62A853BF86E
    GO
    Isoform 3 (identifier: Q8N187-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         27-102: Missing.

    Show »
    Length:649
    Mass (Da):72,385
    Checksum:iA9DE9008C08D9DB8
    GO

    Sequence cautioni

    The sequence BAB69018.1 differs from that shown. Reason: Frameshift at position 715.
    The sequence BAB15088.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti238 – 2381K → E in AAK66819. 1 PublicationCurated
    Sequence conflicti238 – 2381K → E in BAB15088. (PubMed:14702039)Curated
    Sequence conflicti286 – 2861C → R in BAG64929. (PubMed:14702039)Curated
    Sequence conflicti300 – 3012VS → SQ in BAB15088. (PubMed:14702039)Curated
    Sequence conflicti465 – 4651F → L in AAH33777. (PubMed:15489334)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 102102Missing in isoform 2. 1 PublicationVSP_016785Add
    BLAST
    Alternative sequencei27 – 10276Missing in isoform 3. 1 PublicationVSP_055713Add
    BLAST
    Alternative sequencei279 – 30931SRAVV…SRSCQ → TFLKNYFKRFSSSHSPLSKC DFPKVITFLFW in isoform 2. 1 PublicationVSP_016786Add
    BLAST
    Alternative sequencei310 – 725416Missing in isoform 2. 1 PublicationVSP_016787Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB053309 mRNA. Translation: BAB69018.1. Frameshift.
    AB053310 mRNA. Translation: BAB69019.1.
    AY032876 mRNA. Translation: AAK66819.2.
    AF454946 mRNA. Translation: AAL62330.1.
    AK025232 mRNA. Translation: BAB15088.1. Different initiation.
    AK304014 mRNA. Translation: BAG64929.1.
    AC010900 Genomic DNA. Translation: AAY24288.1.
    CH471063 Genomic DNA. Translation: EAW70320.1.
    BC033777 mRNA. Translation: AAH33777.1.
    AL834188 mRNA. Translation: CAD38882.2.
    CCDSiCCDS42801.1. [Q8N187-1]
    RefSeqiNP_001098056.1. NM_001104586.2. [Q8N187-1]
    NP_001269840.1. NM_001282911.1.
    NP_001269841.1. NM_001282912.1.
    NP_079020.13. NM_024744.15. [Q8N187-1]
    XP_005246915.1. XM_005246858.1. [Q8N187-1]
    XP_005246916.1. XM_005246859.1. [Q8N187-1]
    XP_006712820.1. XM_006712757.1. [Q8N187-1]
    UniGeneiHs.444982.

    Genome annotation databases

    EnsembliENST00000320443; ENSP00000316224; ENSG00000138380. [Q8N187-1]
    ENST00000402905; ENSP00000384006; ENSG00000138380. [Q8N187-1]
    ENST00000428585; ENSP00000396221; ENSG00000138380. [Q8N187-3]
    ENST00000434998; ENSP00000415948; ENSG00000138380. [Q8N187-2]
    ENST00000438828; ENSP00000414644; ENSG00000138380. [Q8N187-1]
    GeneIDi79800.
    KEGGihsa:79800.
    UCSCiuc002uzn.3. human. [Q8N187-2]
    uc002uzo.2. human. [Q8N187-1]

    Polymorphism databases

    DMDMi85540610.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB053309 mRNA. Translation: BAB69018.1 . Frameshift.
    AB053310 mRNA. Translation: BAB69019.1 .
    AY032876 mRNA. Translation: AAK66819.2 .
    AF454946 mRNA. Translation: AAL62330.1 .
    AK025232 mRNA. Translation: BAB15088.1 . Different initiation.
    AK304014 mRNA. Translation: BAG64929.1 .
    AC010900 Genomic DNA. Translation: AAY24288.1 .
    CH471063 Genomic DNA. Translation: EAW70320.1 .
    BC033777 mRNA. Translation: AAH33777.1 .
    AL834188 mRNA. Translation: CAD38882.2 .
    CCDSi CCDS42801.1. [Q8N187-1 ]
    RefSeqi NP_001098056.1. NM_001104586.2. [Q8N187-1 ]
    NP_001269840.1. NM_001282911.1.
    NP_001269841.1. NM_001282912.1.
    NP_079020.13. NM_024744.15. [Q8N187-1 ]
    XP_005246915.1. XM_005246858.1. [Q8N187-1 ]
    XP_005246916.1. XM_005246859.1. [Q8N187-1 ]
    XP_006712820.1. XM_006712757.1. [Q8N187-1 ]
    UniGenei Hs.444982.

    3D structure databases

    ProteinModelPortali Q8N187.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 122897. 3 interactions.
    IntActi Q8N187. 3 interactions.
    MINTi MINT-1472416.
    STRINGi 9606.ENSP00000316224.

    PTM databases

    PhosphoSitei Q8N187.

    Polymorphism databases

    DMDMi 85540610.

    Proteomic databases

    PaxDbi Q8N187.
    PRIDEi Q8N187.

    Protocols and materials databases

    DNASUi 79800.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000320443 ; ENSP00000316224 ; ENSG00000138380 . [Q8N187-1 ]
    ENST00000402905 ; ENSP00000384006 ; ENSG00000138380 . [Q8N187-1 ]
    ENST00000428585 ; ENSP00000396221 ; ENSG00000138380 . [Q8N187-3 ]
    ENST00000434998 ; ENSP00000415948 ; ENSG00000138380 . [Q8N187-2 ]
    ENST00000438828 ; ENSP00000414644 ; ENSG00000138380 . [Q8N187-1 ]
    GeneIDi 79800.
    KEGGi hsa:79800.
    UCSCi uc002uzn.3. human. [Q8N187-2 ]
    uc002uzo.2. human. [Q8N187-1 ]

    Organism-specific databases

    CTDi 79800.
    GeneCardsi GC02P203777.
    HGNCi HGNC:14435. CARF.
    HPAi HPA034557.
    MIMi 607586. gene.
    neXtProti NX_Q8N187.
    PharmGKBi PA24748.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG45356.
    HOVERGENi HBG080829.
    InParanoidi Q8N187.
    OMAi QLQPRFT.
    OrthoDBi EOG761BTC.
    PhylomeDBi Q8N187.
    TreeFami TF333279.

    Miscellaneous databases

    GeneWikii ALS2CR8.
    GenomeRNAii 79800.
    NextBioi 69356.
    PROi Q8N187.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q8N187.
    Bgeei Q8N187.
    CleanExi HS_ALS2CR8.
    Genevestigatori Q8N187.

    Family and domain databases

    InterProi IPR029309. CaRF.
    [Graphical view ]
    Pfami PF15299. ALS2CR8. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2).
    2. "NYD-SP24: cloning a novel gene related to testis development from human testis."
      Sha J.H.
      Submitted (AUG-2001) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
      Tissue: Testis.
    3. "A calcium-responsive transcription factor, CaRF, that regulates neuronal activity-dependent expression of BDNF."
      Tao X., West A.E., Chen W.G., Corfas G., Greenberg M.E.
      Neuron 33:383-395(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, DNA-BINDING.
    4. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 29-301 (ISOFORM 1).
      Tissue: Colon and Trachea.
    5. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
      Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
      , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
      Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    6. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    7. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Testis.
    8. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-278 (ISOFORM 1).
      Tissue: Lymph node.
    9. "Regulation of brain-derived neurotrophic factor exon IV transcription through calcium responsive elements in cortical neurons."
      Zheng F., Zhou X., Luo Y., Xiao H., Wayman G., Wang H.
      PLoS ONE 6:E28441-E28441(2011) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION.

    Entry informationi

    Entry nameiCARTF_HUMAN
    AccessioniPrimary (citable) accession number: Q8N187
    Secondary accession number(s): B4E1W7
    , G3V1K7, Q8ND29, Q8WXC0, Q96J78, Q96Q38, Q96Q39, Q9H712
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: January 10, 2006
    Last sequence update: January 10, 2006
    Last modified: October 1, 2014
    This is version 91 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 2
      Human chromosome 2: entries, gene names and cross-references to MIM
    2. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

    External Data

    Dasty 3