Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Leukocyte immunoglobulin-like receptor subfamily A member 2

Gene

LILRA2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Part of the innate immune responses against microbial infection (PubMed:12529506, PubMed:27572839). Specifically recognizes a set of N-terminally truncated immunoglobulins that are produced via cleavage by proteases from a range of pathogenic bacteria and fungi, including L.pneumophila, M.hyorhinis, S.pneumoniae, S.aureus and C.albicans (PubMed:27572839). Recognizes epitopes that are in part in the variable region of the immunoglobulin light chains, but requires also the constant region for signaling (PubMed:27572839). Binds to a subset of cleaved IgM, IgG3 and IgG4 molecules, but does not bind cleaved IgA1 (PubMed:27572839). Binding of N-terminally truncated immunoglobulins mediates activation of neutrophils (PubMed:27572839). In monocytes, activation leads to the release of CSF2, CF3, IL6, CXCL8 and CCL3 and down-regulates responses to bacterial lipopolysaccharide (LPS), possibly via down-regulation of TLR4 expression and reduced signaling via TLR4 (PubMed:22479404). In eosinophils, activation by ligand binding leads to the release of RNASE2, IL4 and leukotriene C4 (PubMed:12529506). Does not bind class I MHC antigens (PubMed:19230061).4 Publications

GO - Molecular functioni

  • antigen binding Source: ProtInc
  • IgM binding Source: UniProtKB
  • signaling receptor activity Source: ProtInc

GO - Biological processi

  • defense response Source: ProtInc
  • granulocyte colony-stimulating factor production Source: UniProtKB
  • granulocyte macrophage colony-stimulating factor production Source: UniProtKB
  • innate immune response Source: UniProtKB-KW
  • innate immune response activating cell surface receptor signaling pathway Source: UniProtKB
  • interleukin-6 production Source: UniProtKB
  • interleukin-8 production Source: UniProtKB
  • negative regulation of lipopolysaccharide-mediated signaling pathway Source: UniProtKB
  • negative regulation of toll-like receptor 4 signaling pathway Source: UniProtKB
  • neutrophil activation involved in immune response Source: UniProtKB
  • signal transduction Source: ProtInc

Keywordsi

Molecular functionReceptor
Biological processImmunity, Innate immunity

Enzyme and pathway databases

ReactomeiR-HSA-198933 Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell

Names & Taxonomyi

Protein namesi
Recommended name:
Leukocyte immunoglobulin-like receptor subfamily A member 2
Alternative name(s):
CD85 antigen-like family member H
Immunoglobulin-like transcript 1
Short name:
ILT-1
Leukocyte immunoglobulin-like receptor 71 Publication
Short name:
LIR-71 Publication
CD_antigen: CD85h
Gene namesi
Name:LILRA2
Synonyms:ILT1, LIR7
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 19

Organism-specific databases

EuPathDBiHostDB:ENSG00000239998.5
HGNCiHGNC:6603 LILRA2
MIMi604812 gene
neXtProtiNX_Q8N149

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini24 – 449ExtracellularSequence analysisAdd BLAST426
Transmembranei450 – 470HelicalSequence analysisAdd BLAST21
Topological domaini471 – 483CytoplasmicSequence analysisAdd BLAST13

Keywords - Cellular componenti

Cell membrane, Membrane, Secreted

Pathology & Biotechi

Organism-specific databases

DisGeNETi11027
PharmGKBiPA30377

Polymorphism and mutation databases

BioMutaiLILRA2
DMDMi37537906

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 23Sequence analysisAdd BLAST23
ChainiPRO_000001481724 – 483Leukocyte immunoglobulin-like receptor subfamily A member 2Add BLAST460

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Disulfide bondi49 ↔ 97PROSITE-ProRule annotation1 Publication
Glycosylationi64N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi103N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi138N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi143 ↔ 195PROSITE-ProRule annotation1 Publication
Disulfide bondi244 ↔ 295PROSITE-ProRule annotation
Glycosylationi279N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi300N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi339N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi344 ↔ 395PROSITE-ProRule annotation
Modified residuei404Nitrated tyrosineBy similarity1
Glycosylationi429N-linked (GlcNAc...) asparagineSequence analysis1

Keywords - PTMi

Disulfide bond, Glycoprotein, Nitration

Proteomic databases

PaxDbiQ8N149
PeptideAtlasiQ8N149
PRIDEiQ8N149

PTM databases

iPTMnetiQ8N149
PhosphoSitePlusiQ8N149

Expressioni

Tissue specificityi

Detected on the surface of all peripheral blood monocytes, neutrophils, basophils and eosinophils (at protein level) (PubMed:12529506, PubMed:22479404). Expression levels are very low or not detectable on monocytes, T-cells, B-cells, dendritic cells and natural killer (NK) cells (PubMed:9548455).3 Publications

Gene expression databases

BgeeiENSG00000239998
CleanExiHS_LILRA2
ExpressionAtlasiQ8N149 baseline and differential
GenevisibleiQ8N149 HS

Interactioni

Subunit structurei

Homodimer.1 Publication

Protein-protein interaction databases

STRINGi9606.ENSP00000251377

Structurei

Secondary structure

1483
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Beta strandi30 – 35Combined sources6
Beta strandi37 – 42Combined sources6
Beta strandi45 – 50Combined sources6
Beta strandi83 – 86Combined sources4
Beta strandi93 – 95Combined sources3
Beta strandi112 – 117Combined sources6
Beta strandi124 – 129Combined sources6
Beta strandi139 – 144Combined sources6
Beta strandi152 – 156Combined sources5
Beta strandi159 – 161Combined sources3
Beta strandi164 – 170Combined sources7
Beta strandi173 – 175Combined sources3
Beta strandi178 – 182Combined sources5
Beta strandi192 – 195Combined sources4
Beta strandi203 – 205Combined sources3

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2OTPX-ray2.60A/B24-219[»]
ProteinModelPortaliQ8N149
SMRiQ8N149
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ8N149

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini27 – 113Ig-like C2-type 1Add BLAST87
Domaini117 – 222Ig-like C2-type 2Add BLAST106
Domaini224 – 313Ig-like C2-type 3Add BLAST90
Domaini324 – 413Ig-like C2-type 4Add BLAST90

Keywords - Domaini

Immunoglobulin domain, Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410IKJD Eukaryota
ENOG41116BR LUCA
HOGENOMiHOG000234395
HOVERGENiHBG074353
InParanoidiQ8N149
KOiK06512
OrthoDBiEOG091G0D6W
PhylomeDBiQ8N149
TreeFamiTF336644

Family and domain databases

Gene3Di2.60.40.10, 4 hits
InterProiView protein in InterPro
IPR016332 A1B_glyco/leuk_Ig-like_rcpt
IPR007110 Ig-like_dom
IPR036179 Ig-like_dom_sf
IPR013783 Ig-like_fold
IPR003599 Ig_sub
IPR003598 Ig_sub2
IPR013151 Immunoglobulin
PfamiView protein in Pfam
PF00047 ig, 1 hit
PF13895 Ig_2, 1 hit
PIRSFiPIRSF001979 Alpha_1B_glycoprot_prd, 1 hit
SMARTiView protein in SMART
SM00409 IG, 4 hits
SM00408 IGc2, 3 hits
SUPFAMiSSF48726 SSF48726, 4 hits
PROSITEiView protein in PROSITE
PS50835 IG_LIKE, 2 hits

Sequences (4)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8N149-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MTPILTVLIC LGLSLGPRTH VQAGHLPKPT LWAEPGSVII QGSPVTLRCQ
60 70 80 90 100
GSLQAEEYHL YRENKSASWV RRIQEPGKNG QFPIPSITWE HAGRYHCQYY
110 120 130 140 150
SHNHSSEYSD PLELVVTGAY SKPTLSALPS PVVTLGGNVT LQCVSQVAFD
160 170 180 190 200
GFILCKEGED EHPQRLNSHS HARGWSWAIF SVGPVSPSRR WSYRCYAYDS
210 220 230 240 250
NSPYVWSLPS DLLELLVPGV SKKPSLSVQP GPMVAPGESL TLQCVSDVGY
260 270 280 290 300
DRFVLYKEGE RDFLQRPGWQ PQAGLSQANF TLGPVSPSHG GQYRCYSAHN
310 320 330 340 350
LSSEWSAPSD PLDILITGQF YDRPSLSVQP VPTVAPGKNV TLLCQSRGQF
360 370 380 390 400
HTFLLTKEGA GHPPLHLRSE HQAQQNQAEF RMGPVTSAHV GTYRCYSSLS
410 420 430 440 450
SNPYLLSLPS DPLELVVSEA AETLSPSQNK TDSTTTSLGQ HPQDYTVENL
460 470 480
IRMGVAGLVL VVLGILLFEA QHSQRSLQDA AGR
Length:483
Mass (Da):52,992
Last modified:October 3, 2003 - v2
Checksum:i6B57FFC81F8CCF6C
GO
Isoform 2 (identifier: Q8N149-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     419-436: EAAETLSPSQNKTDSTTT → A

Note: No experimental confirmation available.
Show »
Length:466
Mass (Da):51,200
Checksum:i29D7B30893D3F5D4
GO
Isoform 3 (identifier: Q8N149-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     12-23: Missing.
     436-483: TSLGQHPQDYTVENLIRMGVAGLVLVVLGILLFEAQHSQRSLQDAAGR → SE

Show »
Length:425
Mass (Da):46,806
Checksum:i4FAE03B1B83C6B1F
GO
Isoform 4 (identifier: Q8N149-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     436-483: TSLGQHPQDYTVENLIRMGVAGLVLVVLGILLFEAQHSQRSLQDAAGR → SE

Show »
Length:437
Mass (Da):48,023
Checksum:iFE62281A2EAC8AC9
GO

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_01698825H → L. Corresponds to variant dbSNP:rs1834697Ensembl.1
Natural variantiVAR_01698925H → N. Corresponds to variant dbSNP:rs1834698Ensembl.1
Natural variantiVAR_056051331V → G. Corresponds to variant dbSNP:rs7249811Ensembl.1
Natural variantiVAR_056052361G → A. Corresponds to variant dbSNP:rs7249154Ensembl.1
Natural variantiVAR_056053381R → C. Corresponds to variant dbSNP:rs7249054Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_05708512 – 23Missing in isoform 3. 1 PublicationAdd BLAST12
Alternative sequenceiVSP_008455419 – 436EAAET…DSTTT → A in isoform 2. 1 PublicationAdd BLAST18
Alternative sequenceiVSP_057086436 – 483TSLGQ…DAAGR → SE in isoform 3 and isoform 4. 1 PublicationAdd BLAST48

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF025531 mRNA Translation: AAB87665.1
EU915609 mRNA Translation: ACK56075.1
EU915610 mRNA Translation: ACK56076.1
BC017412 mRNA Translation: AAH17412.1
BC027916 mRNA Translation: AAH27916.1
CCDSiCCDS12900.1 [Q8N149-2]
CCDS46179.1 [Q8N149-1]
RefSeqiNP_006857.2, NM_006866.3
UniGeneiHs.655593
Hs.739156

Genome annotation databases

EnsembliENST00000251376; ENSP00000251376; ENSG00000239998
ENST00000251377; ENSP00000251377; ENSG00000239998
ENST00000391738; ENSP00000375618; ENSG00000239998
ENST00000611940; ENSP00000478981; ENSG00000275290 [Q8N149-1]
ENST00000613573; ENSP00000479743; ENSG00000275290 [Q8N149-2]
ENST00000616629; ENSP00000481338; ENSG00000275290 [Q8N149-1]
ENST00000617409; ENSP00000479914; ENSG00000274000 [Q8N149-1]
ENST00000620279; ENSP00000480939; ENSG00000274000 [Q8N149-2]
ENST00000621721; ENSP00000484762; ENSG00000278634 [Q8N149-2]
ENST00000622640; ENSP00000483906; ENSG00000278634 [Q8N149-1]
GeneIDi11027
KEGGihsa:11027
UCSCiuc002qgf.5 human [Q8N149-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiLIRA2_HUMAN
AccessioniPrimary (citable) accession number: Q8N149
Secondary accession number(s): O75020
Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 3, 2003
Last sequence update: October 3, 2003
Last modified: May 23, 2018
This is version 141 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Cookie policy

We would like to use anonymized google analytics cookies to gather statistics on how uniprot.org is used in aggregate. Learn more

UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health