Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Leukocyte immunoglobulin-like receptor subfamily A member 2

Gene

LILRA2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Does not bind class I MHC antigens.1 Publication

GO - Molecular functioni

  • antigen binding Source: ProtInc
  • receptor activity Source: ProtInc

GO - Biological processi

  • adaptive immune response Source: UniProtKB-KW
  • defense response Source: ProtInc
  • signal transduction Source: ProtInc
Complete GO annotation...

Keywords - Molecular functioni

Receptor

Keywords - Biological processi

Adaptive immunity, Immunity

Enzyme and pathway databases

BioCyciZFISH:ENSG00000131041-MONOMER.
ReactomeiR-HSA-198933. Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell.

Protein family/group databases

MEROPSiI43.951.

Names & Taxonomyi

Protein namesi
Recommended name:
Leukocyte immunoglobulin-like receptor subfamily A member 2
Alternative name(s):
CD85 antigen-like family member H
Immunoglobulin-like transcript 1
Short name:
ILT-1
Leukocyte immunoglobulin-like receptor 7
Short name:
LIR-7
CD_antigen: CD85h
Gene namesi
Name:LILRA2
Synonyms:ILT1, LIR7
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 19

Organism-specific databases

HGNCiHGNC:6603. LILRA2.

Subcellular locationi

Isoform 4 :

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini24 – 449ExtracellularSequence analysisAdd BLAST426
Transmembranei450 – 470HelicalSequence analysisAdd BLAST21
Topological domaini471 – 483CytoplasmicSequence analysisAdd BLAST13

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Membrane, Secreted

Pathology & Biotechi

Organism-specific databases

DisGeNETi11027.
OpenTargetsiENSG00000274000.
ENSG00000275290.
ENSG00000278634.
PharmGKBiPA30377.

Polymorphism and mutation databases

BioMutaiLILRA2.
DMDMi37537906.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 23Sequence analysisAdd BLAST23
ChainiPRO_000001481724 – 483Leukocyte immunoglobulin-like receptor subfamily A member 2Add BLAST460

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Disulfide bondi49 ↔ 97PROSITE-ProRule annotation1 Publication
Glycosylationi64N-linked (GlcNAc...)Sequence analysis1
Glycosylationi103N-linked (GlcNAc...)Sequence analysis1
Glycosylationi138N-linked (GlcNAc...)Sequence analysis1
Disulfide bondi143 ↔ 195PROSITE-ProRule annotation1 Publication
Disulfide bondi244 ↔ 295PROSITE-ProRule annotation
Glycosylationi279N-linked (GlcNAc...)Sequence analysis1
Glycosylationi300N-linked (GlcNAc...)Sequence analysis1
Glycosylationi339N-linked (GlcNAc...)Sequence analysis1
Disulfide bondi344 ↔ 395PROSITE-ProRule annotation
Modified residuei404Nitrated tyrosineBy similarity1
Glycosylationi429N-linked (GlcNAc...)Sequence analysis1

Keywords - PTMi

Disulfide bond, Glycoprotein, Nitration

Proteomic databases

PaxDbiQ8N149.
PeptideAtlasiQ8N149.
PRIDEiQ8N149.

PTM databases

iPTMnetiQ8N149.
PhosphoSitePlusiQ8N149.

Expressioni

Tissue specificityi

Expression levels are very low or not detectable on monocytes, T-cells, B-cells, dendritic cells and natural killer (NK) cells.1 Publication

Gene expression databases

BgeeiENSG00000239998.
CleanExiHS_LILRA2.
ExpressionAtlasiQ8N149. baseline and differential.
GenevisibleiQ8N149. HS.

Interactioni

Subunit structurei

Homodimer.1 Publication

Protein-protein interaction databases

MINTiMINT-4657831.

Structurei

Secondary structure

1483
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Beta strandi30 – 35Combined sources6
Beta strandi37 – 42Combined sources6
Beta strandi45 – 50Combined sources6
Beta strandi83 – 86Combined sources4
Beta strandi93 – 95Combined sources3
Beta strandi112 – 117Combined sources6
Beta strandi124 – 129Combined sources6
Beta strandi139 – 144Combined sources6
Beta strandi152 – 156Combined sources5
Beta strandi159 – 161Combined sources3
Beta strandi164 – 170Combined sources7
Beta strandi173 – 175Combined sources3
Beta strandi178 – 182Combined sources5
Beta strandi192 – 195Combined sources4
Beta strandi203 – 205Combined sources3

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2OTPX-ray2.60A/B24-219[»]
ProteinModelPortaliQ8N149.
SMRiQ8N149.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ8N149.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini27 – 113Ig-like C2-type 1Add BLAST87
Domaini117 – 222Ig-like C2-type 2Add BLAST106
Domaini224 – 313Ig-like C2-type 3Add BLAST90
Domaini324 – 413Ig-like C2-type 4Add BLAST90

Sequence similaritiesi

Keywords - Domaini

Immunoglobulin domain, Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410IKJD. Eukaryota.
ENOG41116BR. LUCA.
HOGENOMiHOG000234395.
HOVERGENiHBG074353.
InParanoidiQ8N149.
KOiK06512.
OMAiCHYRTEY.
OrthoDBiEOG091G0D6W.
PhylomeDBiQ8N149.
TreeFamiTF336644.

Family and domain databases

Gene3Di2.60.40.10. 4 hits.
InterProiIPR016332. A1B_glyco/leuk_Ig-like_rcpt.
IPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR003599. Ig_sub.
IPR003598. Ig_sub2.
IPR013151. Immunoglobulin.
[Graphical view]
PfamiPF00047. ig. 1 hit.
PF13895. Ig_2. 1 hit.
[Graphical view]
PIRSFiPIRSF001979. Alpha_1B_glycoprot_prd. 1 hit.
SMARTiSM00409. IG. 4 hits.
SM00408. IGc2. 3 hits.
[Graphical view]
SUPFAMiSSF48726. SSF48726. 4 hits.
PROSITEiPS50835. IG_LIKE. 2 hits.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8N149-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MTPILTVLIC LGLSLGPRTH VQAGHLPKPT LWAEPGSVII QGSPVTLRCQ
60 70 80 90 100
GSLQAEEYHL YRENKSASWV RRIQEPGKNG QFPIPSITWE HAGRYHCQYY
110 120 130 140 150
SHNHSSEYSD PLELVVTGAY SKPTLSALPS PVVTLGGNVT LQCVSQVAFD
160 170 180 190 200
GFILCKEGED EHPQRLNSHS HARGWSWAIF SVGPVSPSRR WSYRCYAYDS
210 220 230 240 250
NSPYVWSLPS DLLELLVPGV SKKPSLSVQP GPMVAPGESL TLQCVSDVGY
260 270 280 290 300
DRFVLYKEGE RDFLQRPGWQ PQAGLSQANF TLGPVSPSHG GQYRCYSAHN
310 320 330 340 350
LSSEWSAPSD PLDILITGQF YDRPSLSVQP VPTVAPGKNV TLLCQSRGQF
360 370 380 390 400
HTFLLTKEGA GHPPLHLRSE HQAQQNQAEF RMGPVTSAHV GTYRCYSSLS
410 420 430 440 450
SNPYLLSLPS DPLELVVSEA AETLSPSQNK TDSTTTSLGQ HPQDYTVENL
460 470 480
IRMGVAGLVL VVLGILLFEA QHSQRSLQDA AGR
Length:483
Mass (Da):52,992
Last modified:October 3, 2003 - v2
Checksum:i6B57FFC81F8CCF6C
GO
Isoform 2 (identifier: Q8N149-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     419-436: EAAETLSPSQNKTDSTTT → A

Note: No experimental confirmation available.
Show »
Length:466
Mass (Da):51,200
Checksum:i29D7B30893D3F5D4
GO
Isoform 3 (identifier: Q8N149-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     12-23: Missing.
     436-483: TSLGQHPQDYTVENLIRMGVAGLVLVVLGILLFEAQHSQRSLQDAAGR → SE

Show »
Length:425
Mass (Da):46,806
Checksum:i4FAE03B1B83C6B1F
GO
Isoform 4 (identifier: Q8N149-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     436-483: TSLGQHPQDYTVENLIRMGVAGLVLVVLGILLFEAQHSQRSLQDAAGR → SE

Show »
Length:437
Mass (Da):48,023
Checksum:iFE62281A2EAC8AC9
GO

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_01698825H → L.Corresponds to variant rs1834697dbSNPEnsembl.1
Natural variantiVAR_01698925H → N.Corresponds to variant rs1834698dbSNPEnsembl.1
Natural variantiVAR_056051331V → G.Corresponds to variant rs7249811dbSNPEnsembl.1
Natural variantiVAR_056052361G → A.Corresponds to variant rs7249154dbSNPEnsembl.1
Natural variantiVAR_056053381R → C.Corresponds to variant rs7249054dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_05708512 – 23Missing in isoform 3. 1 PublicationAdd BLAST12
Alternative sequenceiVSP_008455419 – 436EAAET…DSTTT → A in isoform 2. 1 PublicationAdd BLAST18
Alternative sequenceiVSP_057086436 – 483TSLGQ…DAAGR → SE in isoform 3 and isoform 4. 1 PublicationAdd BLAST48

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF025531 mRNA. Translation: AAB87665.1.
EU915609 mRNA. Translation: ACK56075.1.
EU915610 mRNA. Translation: ACK56076.1.
BC017412 mRNA. Translation: AAH17412.1.
BC027916 mRNA. Translation: AAH27916.1.
CCDSiCCDS12900.1. [Q8N149-2]
CCDS46179.1. [Q8N149-1]
RefSeqiNP_006857.2. NM_006866.3.
UniGeneiHs.655593.
Hs.739156.

Genome annotation databases

EnsembliENST00000251376; ENSP00000251376; ENSG00000239998.
ENST00000251377; ENSP00000251377; ENSG00000239998.
ENST00000391738; ENSP00000375618; ENSG00000239998.
ENST00000611940; ENSP00000478981; ENSG00000275290. [Q8N149-1]
ENST00000613573; ENSP00000479743; ENSG00000275290. [Q8N149-2]
ENST00000616629; ENSP00000481338; ENSG00000275290. [Q8N149-1]
ENST00000617409; ENSP00000479914; ENSG00000274000. [Q8N149-1]
ENST00000620279; ENSP00000480939; ENSG00000274000. [Q8N149-2]
ENST00000621721; ENSP00000484762; ENSG00000278634. [Q8N149-2]
ENST00000622640; ENSP00000483906; ENSG00000278634. [Q8N149-1]
GeneIDi11027.
KEGGihsa:11027.
UCSCiuc002qgf.5. human. [Q8N149-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF025531 mRNA. Translation: AAB87665.1.
EU915609 mRNA. Translation: ACK56075.1.
EU915610 mRNA. Translation: ACK56076.1.
BC017412 mRNA. Translation: AAH17412.1.
BC027916 mRNA. Translation: AAH27916.1.
CCDSiCCDS12900.1. [Q8N149-2]
CCDS46179.1. [Q8N149-1]
RefSeqiNP_006857.2. NM_006866.3.
UniGeneiHs.655593.
Hs.739156.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2OTPX-ray2.60A/B24-219[»]
ProteinModelPortaliQ8N149.
SMRiQ8N149.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

MINTiMINT-4657831.

Protein family/group databases

MEROPSiI43.951.

PTM databases

iPTMnetiQ8N149.
PhosphoSitePlusiQ8N149.

Polymorphism and mutation databases

BioMutaiLILRA2.
DMDMi37537906.

Proteomic databases

PaxDbiQ8N149.
PeptideAtlasiQ8N149.
PRIDEiQ8N149.

Protocols and materials databases

DNASUi11027.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000251376; ENSP00000251376; ENSG00000239998.
ENST00000251377; ENSP00000251377; ENSG00000239998.
ENST00000391738; ENSP00000375618; ENSG00000239998.
ENST00000611940; ENSP00000478981; ENSG00000275290. [Q8N149-1]
ENST00000613573; ENSP00000479743; ENSG00000275290. [Q8N149-2]
ENST00000616629; ENSP00000481338; ENSG00000275290. [Q8N149-1]
ENST00000617409; ENSP00000479914; ENSG00000274000. [Q8N149-1]
ENST00000620279; ENSP00000480939; ENSG00000274000. [Q8N149-2]
ENST00000621721; ENSP00000484762; ENSG00000278634. [Q8N149-2]
ENST00000622640; ENSP00000483906; ENSG00000278634. [Q8N149-1]
GeneIDi11027.
KEGGihsa:11027.
UCSCiuc002qgf.5. human. [Q8N149-1]

Organism-specific databases

CTDi11027.
DisGeNETi11027.
GeneCardsiLILRA2.
HGNCiHGNC:6603. LILRA2.
MIMi604812. gene.
neXtProtiNX_Q8N149.
OpenTargetsiENSG00000274000.
ENSG00000275290.
ENSG00000278634.
PharmGKBiPA30377.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IKJD. Eukaryota.
ENOG41116BR. LUCA.
HOGENOMiHOG000234395.
HOVERGENiHBG074353.
InParanoidiQ8N149.
KOiK06512.
OMAiCHYRTEY.
OrthoDBiEOG091G0D6W.
PhylomeDBiQ8N149.
TreeFamiTF336644.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000131041-MONOMER.
ReactomeiR-HSA-198933. Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell.

Miscellaneous databases

ChiTaRSiLILRA2. human.
EvolutionaryTraceiQ8N149.
GeneWikiiLILRA2.
GenomeRNAii11027.
PROiQ8N149.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000239998.
CleanExiHS_LILRA2.
ExpressionAtlasiQ8N149. baseline and differential.
GenevisibleiQ8N149. HS.

Family and domain databases

Gene3Di2.60.40.10. 4 hits.
InterProiIPR016332. A1B_glyco/leuk_Ig-like_rcpt.
IPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR003599. Ig_sub.
IPR003598. Ig_sub2.
IPR013151. Immunoglobulin.
[Graphical view]
PfamiPF00047. ig. 1 hit.
PF13895. Ig_2. 1 hit.
[Graphical view]
PIRSFiPIRSF001979. Alpha_1B_glycoprot_prd. 1 hit.
SMARTiSM00409. IG. 4 hits.
SM00408. IGc2. 3 hits.
[Graphical view]
SUPFAMiSSF48726. SSF48726. 4 hits.
PROSITEiPS50835. IG_LIKE. 2 hits.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiLIRA2_HUMAN
AccessioniPrimary (citable) accession number: Q8N149
Secondary accession number(s): O75020
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 3, 2003
Last sequence update: October 3, 2003
Last modified: November 2, 2016
This is version 130 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human cell differentiation molecules
    CD nomenclature of surface proteins of human leucocytes and list of entries
  2. Human chromosome 19
    Human chromosome 19: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  7. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.