Reviewed,
UniProtKB/Swiss-Prot Q8N139 (ABCA6_HUMAN)
Last modified
November 24, 2009.
Version 58.
History...
Clusters with 100%,
90%,
50% identity |
Documents (5) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: ATP-binding cassette sub-family A member 6 | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Complete proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 1617 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | Probable transporter which may play a role in macrophage lipid homeostasis. |
| Subcellular location | Membrane; Multi-pass membrane protein Potential. |
| Tissue specificity | Widely expressed with higher expression in liver. Ref.1 Ref.2 |
| Developmental stage | Expressed in fetal kidney, lung and liver. Ref.2 |
| Induction | Up-regulated during monocyte differentiation into macrophages. Down-regulated by cholesterol loading of macrophages. Ref.5 |
| Sequence similarities | Belongs to the ABC transporter superfamily. ABCA family. Contains 2 ABC transporter domains. |
| Sequence caution | The sequence AAM77557.1 differs from that shown. Reason: Frameshift at positions 998 and 1000. The sequence AAM77558.1 differs from that shown. Reason: Frameshift at positions 998 and 1000. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Transport |
| Cellular component | Membrane |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Repeat Transmembrane |
| Ligand | ATP-binding Nucleotide-binding |
| PTM | Glycoprotein |
| Technical term | Complete proteome |
| Gene Ontology (GO) | |
| Biological process | transport Inferred from electronic annotation. Source: UniProtKB-KW |
| Cellular component | integral to membrane Inferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular function | ATP binding Inferred from electronic annotation. Source: UniProtKB-KW ATPase activityInferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q8N139-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q8N139-2) Also known as: ABCA6delta-139; The sequence of this isoform differs from the canonical sequence as follows: 636-637: LL → EK 638-1617: Missing. | ||||||
| Isoform 3 (identifier: Q8N139-3) The sequence of this isoform differs from the canonical sequence as follows: 154-185: AHCWDGYGEFSCTLTKYWNRGFVALQTAINTA → GDFPYQISLWNFSCFQHKEQRRLGNRDAFNDT 186-1617: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1617 | 1617 | ATP-binding cassette sub-family A member 6 | PRO_0000250672 | |||||
Regions | |||||||||
| Transmembrane | 31 – 51 | 21 | Potential | ||||||
| Transmembrane | 222 – 242 | 21 | Potential | ||||||
| Transmembrane | 268 – 288 | 21 | Potential | ||||||
| Transmembrane | 297 – 317 | 21 | Potential | ||||||
| Transmembrane | 327 – 347 | 21 | Potential | ||||||
| Transmembrane | 355 – 375 | 21 | Potential | ||||||
| Transmembrane | 397 – 417 | 21 | Potential | ||||||
| Transmembrane | 854 – 874 | 21 | Potential | ||||||
| Transmembrane | 1007 – 1027 | 21 | Potential | ||||||
| Transmembrane | 1062 – 1082 | 21 | Potential | ||||||
| Transmembrane | 1094 – 1114 | 21 | Potential | ||||||
| Transmembrane | 1127 – 1147 | 21 | Potential | ||||||
| Transmembrane | 1150 – 1170 | 21 | Potential | ||||||
| Transmembrane | 1194 – 1214 | 21 | Potential | ||||||
| Domain | 478 – 713 | 236 | ABC transporter 1 | ||||||
| Domain | 1288 – 1513 | 226 | ABC transporter 2 | ||||||
| Nucleotide binding | 514 – 521 | 8 | ATP 1 Potential | ||||||
| Nucleotide binding | 1320 – 1327 | 8 | ATP 2 Potential | ||||||
Amino acid modifications | |||||||||
| Glycosylation | 84 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 109 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 940 | 1 | N-linked (GlcNAc...) Ref.6 | ||||||
Natural variations | |||||||||
| Alternative sequence | 154 – 185 | 32 | AHCWD…AINTA → GDFPYQISLWNFSCFQHKEQ RRLGNRDAFNDT in isoform 3. | VSP_020695 | |||||
| Alternative sequence | 186 – 1617 | 1432 | Missing in isoform 3. | VSP_020696 | |||||
| Alternative sequence | 636 – 637 | 2 | LL → EK in isoform 2. | VSP_020697 | |||||
| Alternative sequence | 638 – 1617 | 980 | Missing in isoform 2. | VSP_020698 | |||||
| Natural variant | 282 | 1 | V → I: dbSNP rs4968839. Ref.2 | VAR_027576 | |||||
| Natural variant | 610 | 1 | N → Y: dbSNP rs9282554. | VAR_027577 | |||||
| Natural variant | 698 | 1 | M → I: dbSNP rs9282553. | VAR_027578 | |||||
| Natural variant | 875 | 1 | M → I: dbSNP rs7212506. Ref.2 | VAR_027579 | |||||
| Natural variant | 1322 | 1 | N → S: dbSNP rs2302134. Ref.2 Ref.4 | VAR_027580 | |||||
Experimental info | |||||||||
| Sequence conflict | 51 | 1 | M → L in AAH70125. Ref.3 | ||||||
| Sequence conflict | 147 | 1 | L → R in AAH70125. Ref.3 | ||||||
| Sequence conflict | 812 | 1 | E → G in BAC04994. Ref.4 | ||||||
| Sequence conflict | 875 – 876 | 2 | MY → IH in BAC04994. Ref.4 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "ABCA6, a novel A subclass ABC transporter." Kaminski W.E., Wenzel J.J., Piehler A., Langmann T., Schmitz G. Biochem. Biophys. Res. Commun. 285:1295-1301(2001) [PubMed: 11478798] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORM 1), ALTERNATIVE SPLICING (ISOFORM 2), TISSUE SPECIFICITY. Tissue: Macrophage. |
| [2] | "Identifying and characterizing a five-gene cluster of ATP-binding cassette transporters mapping to human chromosome 17q24: a new subgroup within the ABCA subfamily." Arnould I., Schriml L.M., Prades C., Lachtermacher-Triunfol M., Schneider T., Maintoux C., Lemoine C., Debono D., Devaud C., Naudin L., Bauche S., Annat M., Annilo T., Allikmets R., Gold B., Denefle P., Rosier M., Dean M. GeneScreen 1:157-164(2001) Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), DEVELOPMENTAL STAGE, TISSUE SPECIFICITY, VARIANTS ILE-282; ILE-875 AND SER-1322. |
| [3] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3). Tissue: Lung. |
| [4] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 801-1617 (ISOFORM 1), VARIANT SER-1322. Tissue: Spleen. |
| [5] | "ABCG1 (ABC8), the human homolog of the Drosophila white gene, is a regulator of macrophage cholesterol and phospholipid transport." Klucken J., Buechler C., Orso E., Kaminski W.E., Porsch-Oezcueruemez M., Liebisch G., Kapinsky M., Diederich W., Drobnik W., Dean M., Allikmets R., Schmitz G. Proc. Natl. Acad. Sci. U.S.A. 97:817-822(2000) [PubMed: 10639163] [Abstract] Cited for: INDUCTION. |
| [6] | "Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry." Chen R., Jiang X., Sun D., Han G., Wang F., Ye M., Wang L., Zou H. J. Proteome Res. 8:651-661(2009) [PubMed: 19159218] [Abstract] Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-940, MASS SPECTROMETRY. Tissue: Liver. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| AF373290 mRNA. Translation: AAM77557.1. Frameshift. AF373328 AF373327 Genomic DNA. Translation: AAM77558.1. Frameshift.AY028898 mRNA. Translation: AAK30023.1. BC070125 mRNA. Translation: AAH70125.1. AK097296 mRNA. Translation: BAC04994.1. Different initiation. | |
| IPI | IPI00295640. IPI00787668. IPI00787757. |
| RefSeq | NP_525023.2. |
| UniGene | Hs.709514 |
3D structure databases | |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | Q8N139. |
Proteomic databases | |
| PRIDE | Q8N139. |
Genome annotation databases | |
| Ensembl | ENST00000284425; ENSP00000284425; ENSG00000154262; Homo sapiens. [Genome view] |
| GeneID | 23460. |
| KEGG | hsa:23460. |
| UCSC | uc002jhw.1. human. uc002jhy.2. human. |
Organism-specific databases | |
| CTD | 23460. |
| GeneCards | GC17M064586. |
| HGNC | HGNC:36. ABCA6. |
| MIM | 612504. gene. |
| PharmGKB | PA24381. |
| GenAtlas | Search... |
Phylogenomic databases | |
| HOVERGEN | Q8N139. |
| OMA | FSYKLKF |
| OrthoDB | EOG9TQPVF |
Enzyme and pathway databases | |
| Reactome | REACT_15518. Transmembrane transport of small molecules. |
Gene expression databases | |
| ArrayExpress | Q8N139. |
| Bgee | Q8N139. |
| CleanEx | HS_ABCA6. |
| Genevestigator | Q8N139. |
| GermOnline | ENSG00000154262. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR003439. ABC_transporter-like. IPR003593. ATPase_AAA+_core. [Graphical view] |
| Pfam | PF00005. ABC_tran. 2 hits. [Graphical view] |
| SMART | SM00382. AAA. 2 hits. [Graphical view] |
| PROSITE | PS00211. ABC_TRANSPORTER_1. False negative. PS50893. ABC_TRANSPORTER_2. 2 hits. [Graphical view] |
| ProtoNet | Search... |
Other Resources | |
| NextBio | 45761. |
| SOURCE | Search... |
Entry information
| Entry name | ABCA6_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q8N139 Secondary accession number(s): Q6NSH9, Q8N856, Q8WWZ6 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 17 Human chromosome 17: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with


