Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q8N139

- ABCA6_HUMAN

UniProt

Q8N139 - ABCA6_HUMAN

Protein

ATP-binding cassette sub-family A member 6

Gene

ABCA6

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 100 (01 Oct 2014)
      Sequence version 2 (03 Oct 2006)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Probable transporter which may play a role in macrophage lipid homeostasis.

    Regions

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Nucleotide bindingi514 – 5218ATP 1PROSITE-ProRule annotation
    Nucleotide bindingi1320 – 13278ATP 2PROSITE-ProRule annotation

    GO - Molecular functioni

    1. ATPase activity Source: InterPro
    2. ATP binding Source: UniProtKB-KW

    GO - Biological processi

    1. transport Source: UniProtKB-KW

    Keywords - Biological processi

    Transport

    Keywords - Ligandi

    ATP-binding, Nucleotide-binding

    Enzyme and pathway databases

    ReactomeiREACT_111158. ABCA transporters in lipid homeostasis.

    Protein family/group databases

    TCDBi3.A.1.211.15. the atp-binding cassette (abc) superfamily.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    ATP-binding cassette sub-family A member 6
    Gene namesi
    Name:ABCA6
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 17

    Organism-specific databases

    HGNCiHGNC:36. ABCA6.

    Subcellular locationi

    GO - Cellular componenti

    1. integral component of membrane Source: UniProtKB-KW

    Keywords - Cellular componenti

    Membrane

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA24381.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 16171617ATP-binding cassette sub-family A member 6PRO_0000250672Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Glycosylationi84 – 841N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi109 – 1091N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi940 – 9401N-linked (GlcNAc...)1 Publication

    Keywords - PTMi

    Glycoprotein

    Proteomic databases

    PaxDbiQ8N139.
    PRIDEiQ8N139.

    PTM databases

    PhosphoSiteiQ8N139.

    Expressioni

    Tissue specificityi

    Widely expressed with higher expression in liver.2 Publications

    Developmental stagei

    Expressed in fetal kidney, lung and liver.1 Publication

    Inductioni

    Up-regulated during monocyte differentiation into macrophages. Down-regulated by cholesterol loading of macrophages.1 Publication

    Gene expression databases

    BgeeiQ8N139.
    CleanExiHS_ABCA6.
    GenevestigatoriQ8N139.

    Interactioni

    Protein-protein interaction databases

    BioGridi117023. 1 interaction.
    IntActiQ8N139. 1 interaction.
    STRINGi9606.ENSP00000284425.

    Structurei

    3D structure databases

    ProteinModelPortaliQ8N139.
    ModBaseiSearch...
    MobiDBiSearch...

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei31 – 5121HelicalSequence AnalysisAdd
    BLAST
    Transmembranei222 – 24221HelicalSequence AnalysisAdd
    BLAST
    Transmembranei268 – 28821HelicalSequence AnalysisAdd
    BLAST
    Transmembranei297 – 31721HelicalSequence AnalysisAdd
    BLAST
    Transmembranei327 – 34721HelicalSequence AnalysisAdd
    BLAST
    Transmembranei355 – 37521HelicalSequence AnalysisAdd
    BLAST
    Transmembranei397 – 41721HelicalSequence AnalysisAdd
    BLAST
    Transmembranei854 – 87421HelicalSequence AnalysisAdd
    BLAST
    Transmembranei1007 – 102721HelicalSequence AnalysisAdd
    BLAST
    Transmembranei1062 – 108221HelicalSequence AnalysisAdd
    BLAST
    Transmembranei1094 – 111421HelicalSequence AnalysisAdd
    BLAST
    Transmembranei1127 – 114721HelicalSequence AnalysisAdd
    BLAST
    Transmembranei1150 – 117021HelicalSequence AnalysisAdd
    BLAST
    Transmembranei1194 – 121421HelicalSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini478 – 713236ABC transporter 1PROSITE-ProRule annotationAdd
    BLAST
    Domaini1288 – 1513226ABC transporter 2PROSITE-ProRule annotationAdd
    BLAST

    Sequence similaritiesi

    Contains 2 ABC transporter domains.PROSITE-ProRule annotation

    Keywords - Domaini

    Repeat, Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiCOG1131.
    HOGENOMiHOG000231057.
    HOVERGENiHBG079884.
    InParanoidiQ8N139.
    KOiK05649.
    OMAiCFQHQRT.
    OrthoDBiEOG73Z2SB.
    PhylomeDBiQ8N139.
    TreeFamiTF105192.

    Family and domain databases

    Gene3Di3.40.50.300. 2 hits.
    InterProiIPR003593. AAA+_ATPase.
    IPR026082. ABC_A.
    IPR003439. ABC_transporter-like.
    IPR027417. P-loop_NTPase.
    [Graphical view]
    PANTHERiPTHR19229. PTHR19229. 1 hit.
    PfamiPF00005. ABC_tran. 2 hits.
    [Graphical view]
    SMARTiSM00382. AAA. 2 hits.
    [Graphical view]
    SUPFAMiSSF52540. SSF52540. 2 hits.
    PROSITEiPS50893. ABC_TRANSPORTER_2. 2 hits.
    [Graphical view]

    Sequences (3)i

    Sequence statusi: Complete.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q8N139-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MNMKQKSVYQ QTKALLCKNF LKKWRMKRES LLEWGLSILL GLCIALFSSS     50
    MRNVQFPGMA PQNLGRVDKF NSSSLMVVYT PISNLTQQIM NKTALAPLLK 100
    GTSVIGAPNK THMDEILLEN LPYAMGIIFN ETFSYKLIFF QGYNSPLWKE 150
    DFSAHCWDGY GEFSCTLTKY WNRGFVALQT AINTAIIEIT TNHPVMEELM 200
    SVTAITMKTL PFITKNLLHN EMFILFFLLH FSPLVYFISL NVTKERKKSK 250
    NLMKMMGLQD SAFWLSWGLI YAGFIFIISI FVTIIITFTQ IIVMTGFMVI 300
    FILFFLYGLS LVALVFLMSV LLKKAVLTNL VVFLLTLFWG CLGFTVFYEQ 350
    LPSSLEWILN ICSPFAFTTG MIQIIKLDYN LNGVIFPDPS GDSYTMIATF 400
    SMLLLDGLIY LLLALYFDKI LPYGDERHYS PLFFLNSSSC FQHQRTNAKV 450
    IEKEIDAEHP SDDYFEPVAP EFQGKEAIRI RNVKKEYKGK SGKVEALKGL 500
    LFDIYEGQIT AILGHSGAGK SSLLNILNGL SVPTEGSVTI YNKNLSEMQD 550
    LEEIRKITGV CPQFNVQFDI LTVKENLSLF AKIKGIHLKE VEQEVQRILL 600
    ELDMQNIQDN LAKHLSEGQK RKLTFGITIL GDPQILLLDE PTTGLDPFSR 650
    DQVWSLLRER RADHVILFST QSMDEADILA DRKVIMSNGR LKCAGSSMFL 700
    KRRWGLGYHL SLHRNEICNP EQITSFITHH IPDAKLKTEN KEKLVYTLPL 750
    ERTNTFPDLF SDLDKCSDQG VTGYDISMST LNEVFMKLEG QSTIEQDFEQ 800
    VEMIRDSESL NEMELAHSSF SEMQTAVSDM GLWRMQVFAM ARLRFLKLKR 850
    QTKVLLTLLL VFGIAIFPLI VENIMYAMLN EKIDWEFKNE LYFLSPGQLP 900
    QEPRTSLLII NNTESNIEDF IKSLKHQNIL LEVDDFENRN GTDGLSYNGA 950
    IIVSGKQKDY RFSVVCNTKR LHCFPILMNI ISNGLLQMFN HTQHIRIESS 1000
    PFPLSHIGLW TGLPDGSFFL FLVLCSISPY ITMGSISDYK KNAKSQLWIS 1050
    GLYTSAYWCG QALVDVSFFI LILLLMYLIF YIENMQYLLI TSQIVFALVI 1100
    VTPGYAASLV FFIYMISFIF RKRRKNSGLW SFYFFFASTI MFSITLINHF 1150
    DLSILITTMV LVPSYTLLGF KTFLEVRDQE HYREFPEANF ELSATDFLVC 1200
    FIPYFQTLLF VFVLRCMELK CGKKRMRKDP VFRISPQSRD AKPNPEEPID 1250
    EDEDIQTERI RTATALTTSI LDEKPVIIAS CLHKEYAGQK KSCFSKRKKK 1300
    IAARNISFCV QEGEILGLLG PNGAGKSSSI RMISGITKPT AGEVELKGCS 1350
    SVLGHLGYCP QENVLWPMLT LREHLEVYAA VKGLRKADAR LAIARLVSAF 1400
    KLHEQLNVPV QKLTAGITRK LCFVLSLLGN SPVLLLDEPS TGIDPTGQQQ 1450
    MWQAIQAVVK NTERGVLLTT HNLAEAEALC DRVAIMVSGR LRCIGSIQHL 1500
    KNKLGKDYIL ELKVKETSQV TLVHTEILKL FPQAAGQERY SSLLTYKLPV 1550
    ADVYPLSQTF HKLEAVKHNF NLEEYSLSQC TLEKVFLELS KEQEVGNFDE 1600
    EIDTTMRWKL LPHSDEP 1617
    Length:1,617
    Mass (Da):184,286
    Last modified:October 3, 2006 - v2
    Checksum:i73940D8050B0A3CA
    GO
    Isoform 2 (identifier: Q8N139-2) [UniParc]FASTAAdd to Basket

    Also known as: ABCA6delta-139

    The sequence of this isoform differs from the canonical sequence as follows:
         636-637: LL → EK
         638-1617: Missing.

    Show »
    Length:637
    Mass (Da):72,522
    Checksum:i22EAA0CCC530DB75
    GO
    Isoform 3 (identifier: Q8N139-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         154-185: AHCWDGYGEFSCTLTKYWNRGFVALQTAINTA → GDFPYQISLWNFSCFQHKEQRRLGNRDAFNDT
         186-1617: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:185
    Mass (Da):21,356
    Checksum:i6B47A3A9A8EAE2A4
    GO

    Sequence cautioni

    The sequence AAM77557.1 differs from that shown. Reason: Frameshift at positions 998 and 1000.
    The sequence AAM77558.1 differs from that shown. Reason: Frameshift at positions 998 and 1000.
    The sequence BAC04994.1 differs from that shown. Reason: Erroneous initiation.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti51 – 511M → L in AAH70125. (PubMed:15489334)Curated
    Sequence conflicti147 – 1471L → R in AAH70125. (PubMed:15489334)Curated
    Sequence conflicti812 – 8121E → G in BAC04994. (PubMed:14702039)Curated
    Sequence conflicti875 – 8762MY → IH in BAC04994. (PubMed:14702039)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti282 – 2821V → I.1 Publication
    Corresponds to variant rs4968839 [ dbSNP | Ensembl ].
    VAR_027576
    Natural varianti610 – 6101N → Y.
    Corresponds to variant rs9282554 [ dbSNP | Ensembl ].
    VAR_027577
    Natural varianti698 – 6981M → I.
    Corresponds to variant rs9282553 [ dbSNP | Ensembl ].
    VAR_027578
    Natural varianti875 – 8751M → I.1 Publication
    Corresponds to variant rs7212506 [ dbSNP | Ensembl ].
    VAR_027579
    Natural varianti1322 – 13221N → S.2 Publications
    Corresponds to variant rs2302134 [ dbSNP | Ensembl ].
    VAR_027580

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei154 – 18532AHCWD…AINTA → GDFPYQISLWNFSCFQHKEQ RRLGNRDAFNDT in isoform 3. 1 PublicationVSP_020695Add
    BLAST
    Alternative sequencei186 – 16171432Missing in isoform 3. 1 PublicationVSP_020696Add
    BLAST
    Alternative sequencei636 – 6372LL → EK in isoform 2. CuratedVSP_020697
    Alternative sequencei638 – 1617980Missing in isoform 2. CuratedVSP_020698Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF373290 mRNA. Translation: AAM77557.1. Frameshift.
    AF373328
    , AF373291, AF373292, AF373293, AF373294, AF373295, AF373296, AF373297, AF373298, AF373299, AF373300, AF373301, AF373302, AF373303, AF373304, AF373305, AF373306, AF373307, AF373308, AF373309, AF373310, AF373311, AF373312, AF373313, AF373314, AF373315, AF373316, AF373317, AF373318, AF373319, AF373320, AF373321, AF373322, AF373323, AF373324, AF373325, AF373326, AF373327 Genomic DNA. Translation: AAM77558.1. Frameshift.
    AY028898 mRNA. Translation: AAK30023.1.
    BC070125 mRNA. Translation: AAH70125.1.
    AK097296 mRNA. Translation: BAC04994.1. Different initiation.
    CCDSiCCDS11683.1. [Q8N139-1]
    RefSeqiNP_525023.2. NM_080284.2. [Q8N139-1]
    XP_006721853.1. XM_006721790.1. [Q8N139-1]
    UniGeneiHs.709514.

    Genome annotation databases

    EnsembliENST00000284425; ENSP00000284425; ENSG00000154262. [Q8N139-1]
    ENST00000590645; ENSP00000466862; ENSG00000154262. [Q8N139-3]
    GeneIDi23460.
    KEGGihsa:23460.
    UCSCiuc002jhw.1. human. [Q8N139-1]
    uc002jhy.3. human. [Q8N139-3]

    Polymorphism databases

    DMDMi115503764.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Web resourcesi

    ABCMdb

    Database for mutations in ABC proteins

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF373290 mRNA. Translation: AAM77557.1 . Frameshift.
    AF373328
    , AF373291 , AF373292 , AF373293 , AF373294 , AF373295 , AF373296 , AF373297 , AF373298 , AF373299 , AF373300 , AF373301 , AF373302 , AF373303 , AF373304 , AF373305 , AF373306 , AF373307 , AF373308 , AF373309 , AF373310 , AF373311 , AF373312 , AF373313 , AF373314 , AF373315 , AF373316 , AF373317 , AF373318 , AF373319 , AF373320 , AF373321 , AF373322 , AF373323 , AF373324 , AF373325 , AF373326 , AF373327 Genomic DNA. Translation: AAM77558.1 . Frameshift.
    AY028898 mRNA. Translation: AAK30023.1 .
    BC070125 mRNA. Translation: AAH70125.1 .
    AK097296 mRNA. Translation: BAC04994.1 . Different initiation.
    CCDSi CCDS11683.1. [Q8N139-1 ]
    RefSeqi NP_525023.2. NM_080284.2. [Q8N139-1 ]
    XP_006721853.1. XM_006721790.1. [Q8N139-1 ]
    UniGenei Hs.709514.

    3D structure databases

    ProteinModelPortali Q8N139.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 117023. 1 interaction.
    IntActi Q8N139. 1 interaction.
    STRINGi 9606.ENSP00000284425.

    Protein family/group databases

    TCDBi 3.A.1.211.15. the atp-binding cassette (abc) superfamily.

    PTM databases

    PhosphoSitei Q8N139.

    Polymorphism databases

    DMDMi 115503764.

    Proteomic databases

    PaxDbi Q8N139.
    PRIDEi Q8N139.

    Protocols and materials databases

    DNASUi 23460.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000284425 ; ENSP00000284425 ; ENSG00000154262 . [Q8N139-1 ]
    ENST00000590645 ; ENSP00000466862 ; ENSG00000154262 . [Q8N139-3 ]
    GeneIDi 23460.
    KEGGi hsa:23460.
    UCSCi uc002jhw.1. human. [Q8N139-1 ]
    uc002jhy.3. human. [Q8N139-3 ]

    Organism-specific databases

    CTDi 23460.
    GeneCardsi GC17M067074.
    H-InvDB HIX0014121.
    HGNCi HGNC:36. ABCA6.
    MIMi 612504. gene.
    neXtProti NX_Q8N139.
    PharmGKBi PA24381.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG1131.
    HOGENOMi HOG000231057.
    HOVERGENi HBG079884.
    InParanoidi Q8N139.
    KOi K05649.
    OMAi CFQHQRT.
    OrthoDBi EOG73Z2SB.
    PhylomeDBi Q8N139.
    TreeFami TF105192.

    Enzyme and pathway databases

    Reactomei REACT_111158. ABCA transporters in lipid homeostasis.

    Miscellaneous databases

    ChiTaRSi ABCA6. human.
    GenomeRNAii 23460.
    NextBioi 45761.
    PROi Q8N139.
    SOURCEi Search...

    Gene expression databases

    Bgeei Q8N139.
    CleanExi HS_ABCA6.
    Genevestigatori Q8N139.

    Family and domain databases

    Gene3Di 3.40.50.300. 2 hits.
    InterProi IPR003593. AAA+_ATPase.
    IPR026082. ABC_A.
    IPR003439. ABC_transporter-like.
    IPR027417. P-loop_NTPase.
    [Graphical view ]
    PANTHERi PTHR19229. PTHR19229. 1 hit.
    Pfami PF00005. ABC_tran. 2 hits.
    [Graphical view ]
    SMARTi SM00382. AAA. 2 hits.
    [Graphical view ]
    SUPFAMi SSF52540. SSF52540. 2 hits.
    PROSITEi PS50893. ABC_TRANSPORTER_2. 2 hits.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORM 1), ALTERNATIVE SPLICING (ISOFORM 2), TISSUE SPECIFICITY.
      Tissue: Macrophage.
    2. "Identifying and characterizing a five-gene cluster of ATP-binding cassette transporters mapping to human chromosome 17q24: a new subgroup within the ABCA subfamily."
      Arnould I., Schriml L.M., Prades C., Lachtermacher-Triunfol M., Schneider T., Maintoux C., Lemoine C., Debono D., Devaud C., Naudin L., Bauche S., Annat M., Annilo T., Allikmets R., Gold B., Denefle P., Rosier M., Dean M.
      GeneScreen 1:157-164(2001)
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), DEVELOPMENTAL STAGE, TISSUE SPECIFICITY, VARIANTS ILE-282; ILE-875 AND SER-1322.
    3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
      Tissue: Lung.
    4. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 801-1617 (ISOFORM 1), VARIANT SER-1322.
      Tissue: Spleen.
    5. "ABCG1 (ABC8), the human homolog of the Drosophila white gene, is a regulator of macrophage cholesterol and phospholipid transport."
      Klucken J., Buechler C., Orso E., Kaminski W.E., Porsch-Oezcueruemez M., Liebisch G., Kapinsky M., Diederich W., Drobnik W., Dean M., Allikmets R., Schmitz G.
      Proc. Natl. Acad. Sci. U.S.A. 97:817-822(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: INDUCTION.
    6. "Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry."
      Chen R., Jiang X., Sun D., Han G., Wang F., Ye M., Wang L., Zou H.
      J. Proteome Res. 8:651-661(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-940.
      Tissue: Liver.

    Entry informationi

    Entry nameiABCA6_HUMAN
    AccessioniPrimary (citable) accession number: Q8N139
    Secondary accession number(s): Q6NSH9, Q8N856, Q8WWZ6
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: October 3, 2006
    Last sequence update: October 3, 2006
    Last modified: October 1, 2014
    This is version 100 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 17
      Human chromosome 17: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3