Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Mesoderm induction early response protein 1

Gene

MIER1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Transcriptional repressor regulating the expression of a number of genes including SP1 target genes. Probably functions through recruitment of HDAC1 a histone deacetylase involved in chromatin silencing.1 Publication

GO - Molecular functioni

  • DNA binding Source: InterPro
  • signal transducer activity Source: UniProtKB

GO - Biological processi

  • positive regulation of chromatin silencing Source: UniProtKB
  • positive regulation of I-kappaB kinase/NF-kappaB signaling Source: UniProtKB
  • transcription, DNA-templated Source: UniProtKB-KW
Complete GO annotation...

Keywords - Molecular functioni

Repressor

Keywords - Biological processi

Transcription, Transcription regulation

Names & Taxonomyi

Protein namesi
Recommended name:
Mesoderm induction early response protein 1
Short name:
Early response 1
Short name:
Er1
Short name:
Mi-er1
Short name:
hMi-er1
Gene namesi
Name:MIER1
Synonyms:KIAA1610
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

HGNCiHGNC:29657. MIER1.

Subcellular locationi

GO - Cellular componenti

  • cytoplasm Source: UniProtKB-SubCell
  • nucleoplasm Source: HPA
  • transcriptional repressor complex Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi214 – 2141W → A: Loss of transcriptional repression and HDAC1 recruitment activity. 1 Publication
Mutagenesisi227 – 2282FL → AA: Loss of transcriptional repression and HDAC1 recruitment activity. 1 Publication

Organism-specific databases

PharmGKBiPA142671456.

Polymorphism and mutation databases

BioMutaiMIER1.
DMDMi380865399.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 512512Mesoderm induction early response protein 1PRO_0000197141Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei10 – 101PhosphoserineCombined sources
Modified residuei141 – 1411PhosphoserineCombined sources
Modified residuei155 – 1551PhosphotyrosineCombined sources
Modified residuei160 – 1601PhosphoserineCombined sources
Modified residuei166 – 1661PhosphoserineCombined sources
Modified residuei367 – 3671PhosphoserineCombined sources
Modified residuei369 – 3691PhosphoserineCombined sources
Modified residuei377 – 3771PhosphoserineCombined sources
Cross-linki420 – 420Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Modified residuei448 – 4481PhosphothreonineCombined sources
Modified residuei483 – 4831PhosphoserineCombined sources
Modified residuei488 – 4881PhosphoserineCombined sources
Modified residuei491 – 4911PhosphoserineCombined sources

Keywords - PTMi

Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

EPDiQ8N108.
MaxQBiQ8N108.
PaxDbiQ8N108.
PeptideAtlasiQ8N108.
PRIDEiQ8N108.

PTM databases

iPTMnetiQ8N108.
PhosphoSiteiQ8N108.

Expressioni

Tissue specificityi

Ubiquitously expressed, but at very low levels. However, consistent level of expression are observed in heart, testis, thyroid, ovary and adrenal gland. Transcripts are up-regulated in breast carcinoma cell lines and tumor.2 Publications

Gene expression databases

BgeeiENSG00000198160.
CleanExiHS_MIER1.
GenevisibleiQ8N108. HS.

Organism-specific databases

HPAiHPA019589.
HPA050306.

Interactioni

Subunit structurei

Interacts with HDAC1. Part of a complex containing at least CDYL, MIER1, MIER2, HDAC1 and HDAC2.2 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
HDAC1Q135477EBI-3504940,EBI-301834
TMEM171Q8WVE63EBI-10264833,EBI-10264837

Protein-protein interaction databases

BioGridi121732. 32 interactions.
IntActiQ8N108. 19 interactions.
MINTiMINT-4534304.
STRINGi9606.ENSP00000383820.

Structurei

3D structure databases

ProteinModelPortaliQ8N108.
SMRiQ8N108. Positions 288-333.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini180 – 27899ELM2PROSITE-ProRule annotationAdd
BLAST
Domaini283 – 33553SANTPROSITE-ProRule annotationAdd
BLAST

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni180 – 284105Interaction with HDAC1Add
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi36 – 181146Glu-richAdd
BLAST

Sequence similaritiesi

Contains 1 ELM2 domain.PROSITE-ProRule annotation
Contains 1 SANT domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiKOG4329. Eukaryota.
ENOG410Y9DJ. LUCA.
GeneTreeiENSGT00510000046482.
HOGENOMiHOG000015798.
HOVERGENiHBG052923.
InParanoidiQ8N108.
OMAiNSNGCSQ.
OrthoDBiEOG091G0BKH.
TreeFamiTF106453.

Family and domain databases

InterProiIPR000949. ELM2_dom.
IPR009057. Homeodomain-like.
IPR031169. MIER1.
IPR001005. SANT/Myb.
IPR017884. SANT_dom.
[Graphical view]
PANTHERiPTHR10865:SF24. PTHR10865:SF24. 1 hit.
PfamiPF01448. ELM2. 1 hit.
PF00249. Myb_DNA-binding. 1 hit.
[Graphical view]
SMARTiSM01189. ELM2. 1 hit.
SM00717. SANT. 1 hit.
[Graphical view]
SUPFAMiSSF46689. SSF46689. 1 hit.
PROSITEiPS51156. ELM2. 1 hit.
PS51293. SANT. 1 hit.
[Graphical view]

Sequences (10)i

Sequence statusi: Complete.

This entry describes 10 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8N108-11) [UniParc]FASTAAdd to basket
Also known as: N3-beta

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAEPSVESSS PGGSATSDDH EFDPSADMLV HDFDDERTLE EEEMMEGETN
60 70 80 90 100
FSSEIEDLAR EGDMPIHELL SLYGYGSTVR LPEEDEEEEE EEEEGEDDED
110 120 130 140 150
ADNDDNSGCS GENKEENIKD SSGQEDETQS SNDDPSQSVA SQDAQEIIRP
160 170 180 190 200
RRCKYFDTNS EVEEESEEDE DYIPSEDWKK EIMVGSMFQA EIPVGICRYK
210 220 230 240 250
ENEKVYENDD QLLWDPEYLP EDKVIIFLKD ASRRTGDEKG VEAIPEGSHI
260 270 280 290 300
KDNEQALYEL VKCNFDTEEA LRRLRFNVKA AREELSVWTE EECRNFEQGL
310 320 330 340 350
KAYGKDFHLI QANKVRTRSV GECVAFYYMW KKSERYDFFA QQTRFGKKKY
360 370 380 390 400
NLHPGVTDYM DRLLDESESA ASSRAPSPPP TASNSSNSQS EKEDGTVSTA
410 420 430 440 450
NQNGVSSNGP GEILNKEEVK VEGLHINGPT GGNKKPLHAD MDTNGYETDN
460 470 480 490 500
LTTDPKLAHM TARNENDFDE KSERPAKRRR VNSNGKESPG SSEFFQEAVS
510
HGKFEELENT DD
Length:512
Mass (Da):57,983
Last modified:March 21, 2012 - v2
Checksum:i182C92C7FC5063AD
GO
Isoform 2 (identifier: Q8N108-12) [UniParc]FASTAAdd to basket
Also known as: N2-beta

The sequence of this isoform differs from the canonical sequence as follows:
     1-3: MAE → MDGASSGGGGSSEGGGGSSGSGYGVVARFSQCLAEFRTWLRTNWLRFNADKTDVML

Note: It is uncertain whether Met-1 or Met-55 is the initiator.Curated
Show »
Length:565
Mass (Da):63,426
Checksum:i16185DC567BFE39A
GO
Isoform 3 (identifier: Q8N108-13) [UniParc]FASTAAdd to basket
Also known as: N1-beta

The sequence of this isoform differs from the canonical sequence as follows:
     1-3: MAE → MFMFNWFTDCLWTLFLSNYQ

Show »
Length:529
Mass (Da):60,242
Checksum:iD8F1B4A1670CCB50
GO
Isoform 4 (identifier: Q8N108-14) [UniParc]FASTAAdd to basket
Also known as: N1-alpha

The sequence of this isoform differs from the canonical sequence as follows:
     1-3: MAE → MFMFNWFTDCLWTLFLSNYQ
     412-433: EILNKEEVKVEGLHINGPTGGN → ILQMLLPVHFSAISSRANAFLK
     434-512: Missing.

Show »
Length:450
Mass (Da):51,357
Checksum:iB339B7E0000983DB
GO
Isoform 5 (identifier: Q8N108-15) [UniParc]FASTAAdd to basket
Also known as: N2-alpha

The sequence of this isoform differs from the canonical sequence as follows:
     1-3: MAE → MDGASSGGGGSSEGGGGSSGSGYGVVARFSQCLAEFRTWLRTNWLRFNADKTDVML
     412-433: EILNKEEVKVEGLHINGPTGGN → ILQMLLPVHFSAISSRANAFLK
     434-512: Missing.

Note: It is uncertain whether Met-1 or Met-55 is the initiator.Curated
Show »
Length:486
Mass (Da):54,541
Checksum:i8D36479DEC980333
GO
Isoform 6 (identifier: Q8N108-16) [UniParc]FASTAAdd to basket
Also known as: N3-alpha

The sequence of this isoform differs from the canonical sequence as follows:
     412-433: EILNKEEVKVEGLHINGPTGGN → ILQMLLPVHFSAISSRANAFLK
     434-512: Missing.

Show »
Length:433
Mass (Da):49,098
Checksum:i9750760C605BDBE5
GO
Isoform 7 (identifier: Q8N108-17) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-27: Missing.

Note: No experimental confirmation available.
Show »
Length:485
Mass (Da):55,292
Checksum:iCC3F2EB3F7A9E6CD
GO
Isoform 8 (identifier: Q8N108-18) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-3: MAE → MFMFNWFTDCLWTLFLSNYQ
     432-512: GNKKPLHADM...KFEELENTDD → ILQMLLPVHFSAISSRANAFLK

Show »
Length:470
Mass (Da):53,515
Checksum:i5FE1BD4941041D64
GO
Isoform 9 (identifier: Q8N108-19) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-63: Missing.
     412-512: EILNKEEVKV...KFEELENTDD → ILQMLLPVHFSAISSRANAFLK

Show »
Length:370
Mass (Da):42,175
Checksum:i9651C040068C7B86
GO
Isoform 10 (identifier: Q8N108-20) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-3: MAE → MFMFNWFTDCLWTLFLSNYQ
     61-64: EGDM → VNNM
     65-512: Missing.

Show »
Length:81
Mass (Da):9,357
Checksum:iEFDE957922641076
GO

Sequence cautioni

The sequence AAH17423 differs from that shown.Wrong choice of CDS. Probable cloning artifact due to reverse transcription from RNA internal poly-A tracts.Curated
The sequence AAM76041 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence AAM97500 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence AAM97503 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence AAM97506 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence BAC11339 differs from that shown.Chimeric cDNA. C-terminal is identical to the product of the WLS gene.Curated
The sequence CAD89921 differs from that shown.Wrong choice of CDS.Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti14 – 141S → P in BC066898 (PubMed:15489334).Curated
Sequence conflicti142 – 1421Q → H in CAH10526 (PubMed:17974005).Curated
Sequence conflicti156 – 1561F → S in BAC11339 (PubMed:14702039).Curated
Sequence conflicti237 – 2371D → G in CAH10526 (PubMed:17974005).Curated
Isoform 2 (identifier: Q8N108-12)
Sequence conflicti1 – 11M → L in AAM76041 (PubMed:12242014).Curated
Sequence conflicti1 – 11M → L in AAM97503 (PubMed:12242014).Curated
Sequence conflicti1 – 11M → L in AAM97506 (PubMed:12242014).Curated
Isoform 5 (identifier: Q8N108-15)
Sequence conflicti1 – 11M → L in AAM97500 (PubMed:12242014).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 6363Missing in isoform 9. 1 PublicationVSP_044343Add
BLAST
Alternative sequencei1 – 2727Missing in isoform 7. 1 PublicationVSP_042449Add
BLAST
Alternative sequencei1 – 33MAE → MDGASSGGGGSSEGGGGSSG SGYGVVARFSQCLAEFRTWL RTNWLRFNADKTDVML in isoform 2 and isoform 5. 2 PublicationsVSP_042450
Alternative sequencei1 – 33MAE → MFMFNWFTDCLWTLFLSNYQ in isoform 3, isoform 4, isoform 8 and isoform 10. 3 PublicationsVSP_042451
Alternative sequencei61 – 644EGDM → VNNM in isoform 10. 1 PublicationVSP_055710
Alternative sequencei65 – 512448Missing in isoform 10. 1 PublicationVSP_055711Add
BLAST
Alternative sequencei412 – 512101EILNK…ENTDD → ILQMLLPVHFSAISSRANAF LK in isoform 9. 1 PublicationVSP_044344Add
BLAST
Alternative sequencei412 – 43322EILNK…PTGGN → ILQMLLPVHFSAISSRANAF LK in isoform 4, isoform 5 and isoform 6. 1 PublicationVSP_042452Add
BLAST
Alternative sequencei432 – 51281GNKKP…ENTDD → ILQMLLPVHFSAISSRANAF LK in isoform 8. 1 PublicationVSP_043218Add
BLAST
Alternative sequencei434 – 51279Missing in isoform 4, isoform 5 and isoform 6. 1 PublicationVSP_042453Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF515446 mRNA. Translation: AAM76040.1.
AF515447 mRNA. Translation: AAM76041.1. Different initiation.
AF515448 mRNA. Translation: AAM76042.2.
AY124186 mRNA. Translation: AAM97499.2.
AY124187 mRNA. Translation: AAM97500.1. Different initiation.
AY124188 mRNA. Translation: AAM97501.1.
AY124189 mRNA. Translation: AAM97502.2.
AY124190 mRNA. Translation: AAM97503.1. Different initiation.
AY124191 mRNA. Translation: AAM97504.1.
AY124192 mRNA. Translation: AAM97505.2.
AY124193 mRNA. Translation: AAM97506.1. Different initiation.
AY124194 mRNA. Translation: AAM97507.1.
AK074990 mRNA. Translation: BAC11339.1. Sequence problems.
AK302061 mRNA. Translation: BAG63451.1.
AL831987 mRNA. Translation: CAD89921.1. Sequence problems.
CR627441 mRNA. Translation: CAH10526.1.
AL139216, AL500525 Genomic DNA. Translation: CAI18873.1.
AL139216, AL500525 Genomic DNA. Translation: CAI18874.1.
AL139216, AL500525 Genomic DNA. Translation: CAI18875.1.
AL139216, AL500525 Genomic DNA. Translation: CAI18876.1.
AL139216, AL500525 Genomic DNA. Translation: CAI18878.1.
AL139216, AL500525 Genomic DNA. Translation: CAI18879.1.
AL500525, AL139216 Genomic DNA. Translation: CAI23427.1.
AL500525, AL139216 Genomic DNA. Translation: CAI23428.1.
AL500525, AL139216 Genomic DNA. Translation: CAI23429.1.
AL500525, AL139216 Genomic DNA. Translation: CAI23430.1.
AL500525, AL139216 Genomic DNA. Translation: CAI23431.1.
AL500525, AL139216 Genomic DNA. Translation: CAI23432.1.
CH471059 Genomic DNA. Translation: EAX06505.1.
CH471059 Genomic DNA. Translation: EAX06508.1.
BC017423 mRNA. Translation: AAH17423.1. Sequence problems.
BC066898 mRNA. No translation available.
BC108726 mRNA. Translation: AAI08727.1.
BC125217 mRNA. Translation: AAI25218.1.
BC125218 mRNA. Translation: AAI25219.1.
AB046830 mRNA. Translation: BAB13436.1.
CCDSiCCDS41347.1. [Q8N108-16]
CCDS41348.1. [Q8N108-11]
CCDS53325.1. [Q8N108-15]
CCDS53326.1. [Q8N108-12]
CCDS53327.1. [Q8N108-14]
CCDS53328.1. [Q8N108-18]
CCDS53329.1. [Q8N108-13]
CCDS53330.1. [Q8N108-19]
CCDS60163.1. [Q8N108-20]
RefSeqiNP_001071168.2. NM_001077700.2. [Q8N108-12]
NP_001071169.1. NM_001077701.2. [Q8N108-11]
NP_001071170.2. NM_001077702.2. [Q8N108-14]
NP_001071171.2. NM_001077703.2. [Q8N108-15]
NP_001071172.1. NM_001077704.2. [Q8N108-16]
NP_001139582.1. NM_001146110.1. [Q8N108-13]
NP_001139583.1. NM_001146111.1. [Q8N108-18]
NP_001139584.1. NM_001146112.1. [Q8N108-17]
NP_001139585.1. NM_001146113.1. [Q8N108-19]
NP_001265144.1. NM_001278215.1. [Q8N108-20]
NP_065999.2. NM_020948.3. [Q8N108-13]
XP_005271133.1. XM_005271076.3. [Q8N108-13]
UniGeneiHs.605432.

Genome annotation databases

EnsembliENST00000355356; ENSP00000347514; ENSG00000198160. [Q8N108-11]
ENST00000355977; ENSP00000348253; ENSG00000198160. [Q8N108-19]
ENST00000357692; ENSP00000350321; ENSG00000198160. [Q8N108-13]
ENST00000371012; ENSP00000360051; ENSG00000198160. [Q8N108-20]
ENST00000371014; ENSP00000360053; ENSG00000198160. [Q8N108-15]
ENST00000371016; ENSP00000360055; ENSG00000198160. [Q8N108-14]
ENST00000371018; ENSP00000360057; ENSG00000198160. [Q8N108-18]
ENST00000401041; ENSP00000383820; ENSG00000198160. [Q8N108-12]
ENST00000401042; ENSP00000383821; ENSG00000198160. [Q8N108-16]
GeneIDi57708.
KEGGihsa:57708.
UCSCiuc001dda.6. human. [Q8N108-11]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF515446 mRNA. Translation: AAM76040.1.
AF515447 mRNA. Translation: AAM76041.1. Different initiation.
AF515448 mRNA. Translation: AAM76042.2.
AY124186 mRNA. Translation: AAM97499.2.
AY124187 mRNA. Translation: AAM97500.1. Different initiation.
AY124188 mRNA. Translation: AAM97501.1.
AY124189 mRNA. Translation: AAM97502.2.
AY124190 mRNA. Translation: AAM97503.1. Different initiation.
AY124191 mRNA. Translation: AAM97504.1.
AY124192 mRNA. Translation: AAM97505.2.
AY124193 mRNA. Translation: AAM97506.1. Different initiation.
AY124194 mRNA. Translation: AAM97507.1.
AK074990 mRNA. Translation: BAC11339.1. Sequence problems.
AK302061 mRNA. Translation: BAG63451.1.
AL831987 mRNA. Translation: CAD89921.1. Sequence problems.
CR627441 mRNA. Translation: CAH10526.1.
AL139216, AL500525 Genomic DNA. Translation: CAI18873.1.
AL139216, AL500525 Genomic DNA. Translation: CAI18874.1.
AL139216, AL500525 Genomic DNA. Translation: CAI18875.1.
AL139216, AL500525 Genomic DNA. Translation: CAI18876.1.
AL139216, AL500525 Genomic DNA. Translation: CAI18878.1.
AL139216, AL500525 Genomic DNA. Translation: CAI18879.1.
AL500525, AL139216 Genomic DNA. Translation: CAI23427.1.
AL500525, AL139216 Genomic DNA. Translation: CAI23428.1.
AL500525, AL139216 Genomic DNA. Translation: CAI23429.1.
AL500525, AL139216 Genomic DNA. Translation: CAI23430.1.
AL500525, AL139216 Genomic DNA. Translation: CAI23431.1.
AL500525, AL139216 Genomic DNA. Translation: CAI23432.1.
CH471059 Genomic DNA. Translation: EAX06505.1.
CH471059 Genomic DNA. Translation: EAX06508.1.
BC017423 mRNA. Translation: AAH17423.1. Sequence problems.
BC066898 mRNA. No translation available.
BC108726 mRNA. Translation: AAI08727.1.
BC125217 mRNA. Translation: AAI25218.1.
BC125218 mRNA. Translation: AAI25219.1.
AB046830 mRNA. Translation: BAB13436.1.
CCDSiCCDS41347.1. [Q8N108-16]
CCDS41348.1. [Q8N108-11]
CCDS53325.1. [Q8N108-15]
CCDS53326.1. [Q8N108-12]
CCDS53327.1. [Q8N108-14]
CCDS53328.1. [Q8N108-18]
CCDS53329.1. [Q8N108-13]
CCDS53330.1. [Q8N108-19]
CCDS60163.1. [Q8N108-20]
RefSeqiNP_001071168.2. NM_001077700.2. [Q8N108-12]
NP_001071169.1. NM_001077701.2. [Q8N108-11]
NP_001071170.2. NM_001077702.2. [Q8N108-14]
NP_001071171.2. NM_001077703.2. [Q8N108-15]
NP_001071172.1. NM_001077704.2. [Q8N108-16]
NP_001139582.1. NM_001146110.1. [Q8N108-13]
NP_001139583.1. NM_001146111.1. [Q8N108-18]
NP_001139584.1. NM_001146112.1. [Q8N108-17]
NP_001139585.1. NM_001146113.1. [Q8N108-19]
NP_001265144.1. NM_001278215.1. [Q8N108-20]
NP_065999.2. NM_020948.3. [Q8N108-13]
XP_005271133.1. XM_005271076.3. [Q8N108-13]
UniGeneiHs.605432.

3D structure databases

ProteinModelPortaliQ8N108.
SMRiQ8N108. Positions 288-333.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi121732. 32 interactions.
IntActiQ8N108. 19 interactions.
MINTiMINT-4534304.
STRINGi9606.ENSP00000383820.

PTM databases

iPTMnetiQ8N108.
PhosphoSiteiQ8N108.

Polymorphism and mutation databases

BioMutaiMIER1.
DMDMi380865399.

Proteomic databases

EPDiQ8N108.
MaxQBiQ8N108.
PaxDbiQ8N108.
PeptideAtlasiQ8N108.
PRIDEiQ8N108.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000355356; ENSP00000347514; ENSG00000198160. [Q8N108-11]
ENST00000355977; ENSP00000348253; ENSG00000198160. [Q8N108-19]
ENST00000357692; ENSP00000350321; ENSG00000198160. [Q8N108-13]
ENST00000371012; ENSP00000360051; ENSG00000198160. [Q8N108-20]
ENST00000371014; ENSP00000360053; ENSG00000198160. [Q8N108-15]
ENST00000371016; ENSP00000360055; ENSG00000198160. [Q8N108-14]
ENST00000371018; ENSP00000360057; ENSG00000198160. [Q8N108-18]
ENST00000401041; ENSP00000383820; ENSG00000198160. [Q8N108-12]
ENST00000401042; ENSP00000383821; ENSG00000198160. [Q8N108-16]
GeneIDi57708.
KEGGihsa:57708.
UCSCiuc001dda.6. human. [Q8N108-11]

Organism-specific databases

CTDi57708.
GeneCardsiMIER1.
HGNCiHGNC:29657. MIER1.
HPAiHPA019589.
HPA050306.
neXtProtiNX_Q8N108.
PharmGKBiPA142671456.
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG4329. Eukaryota.
ENOG410Y9DJ. LUCA.
GeneTreeiENSGT00510000046482.
HOGENOMiHOG000015798.
HOVERGENiHBG052923.
InParanoidiQ8N108.
OMAiNSNGCSQ.
OrthoDBiEOG091G0BKH.
TreeFamiTF106453.

Miscellaneous databases

ChiTaRSiMIER1. human.
GeneWikiiMIER1.
GenomeRNAii57708.
PROiQ8N108.

Gene expression databases

BgeeiENSG00000198160.
CleanExiHS_MIER1.
GenevisibleiQ8N108. HS.

Family and domain databases

InterProiIPR000949. ELM2_dom.
IPR009057. Homeodomain-like.
IPR031169. MIER1.
IPR001005. SANT/Myb.
IPR017884. SANT_dom.
[Graphical view]
PANTHERiPTHR10865:SF24. PTHR10865:SF24. 1 hit.
PfamiPF01448. ELM2. 1 hit.
PF00249. Myb_DNA-binding. 1 hit.
[Graphical view]
SMARTiSM01189. ELM2. 1 hit.
SM00717. SANT. 1 hit.
[Graphical view]
SUPFAMiSSF46689. SSF46689. 1 hit.
PROSITEiPS51156. ELM2. 1 hit.
PS51293. SANT. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiMIER1_HUMAN
AccessioniPrimary (citable) accession number: Q8N108
Secondary accession number(s): C9JFD4
, Q08AE0, Q32NC4, Q5T104, Q5TAD1, Q5TAD2, Q5TAD4, Q5TAD5, Q6AHY8, Q86TB4, Q8N156, Q8N161, Q8NC37, Q8NES4, Q8NES5, Q8NES6, Q8WWG2, Q9HCG2
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 22, 2005
Last sequence update: March 21, 2012
Last modified: September 7, 2016
This is version 132 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.