Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Sperm-associated antigen 16 protein

Gene

SPAG16

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at transcript leveli

Functioni

Necessary for sperm flagellar function. Plays a role in motile ciliogenesis. May help to recruit STK36 to the cilium or apical surface of the cell to initiate subsequent steps of construction of the central pair apparatus of motile cilia (By similarity).By similarity

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

Cilium biogenesis/degradation

Enzyme and pathway databases

SignaLinkiQ8N0X2.

Names & Taxonomyi

Protein namesi
Recommended name:
Sperm-associated antigen 16 protein
Alternative name(s):
Pf20 protein homolog
Gene namesi
Name:SPAG16
Synonyms:PF20
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 2

Organism-specific databases

HGNCiHGNC:23225. SPAG16.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cell projection, Cilium, Cytoplasm, Cytoskeleton, Flagellum

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134887898.

Polymorphism and mutation databases

BioMutaiSPAG16.
DMDMi146329993.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 631631Sperm-associated antigen 16 proteinPRO_0000051223Add
BLAST

Post-translational modificationi

Phosphorylated by TSSK2.By similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiQ8N0X2.
PRIDEiQ8N0X2.

PTM databases

iPTMnetiQ8N0X2.
PhosphoSiteiQ8N0X2.

Expressioni

Tissue specificityi

Isoform 1 is detected in testis. Isoform 4 is detected in testis and brain, and at lower levels in kidney, heart, pancreas, thyroid, ovary, adrenal gland, spinal cord, trachea and liver.2 Publications

Gene expression databases

BgeeiQ8N0X2.
CleanExiHS_SPAG16.
ExpressionAtlasiQ8N0X2. baseline and differential.
GenevisibleiQ8N0X2. HS.

Organism-specific databases

HPAiHPA037542.

Interactioni

Subunit structurei

Interacts with SPAG6 and STK36.By similarity

Protein-protein interaction databases

BioGridi122726. 1 interaction.
IntActiQ8N0X2. 1 interaction.
STRINGi9606.ENSP00000332592.

Structurei

3D structure databases

ProteinModelPortaliQ8N0X2.
SMRiQ8N0X2. Positions 284-631.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Repeati350 – 38940WD 1Add
BLAST
Repeati392 – 43140WD 2Add
BLAST
Repeati434 – 47340WD 3Add
BLAST
Repeati476 – 51540WD 4Add
BLAST
Repeati518 – 55740WD 5Add
BLAST
Repeati560 – 60041WD 6Add
BLAST
Repeati601 – 63030WD 7Add
BLAST

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili152 – 267116Sequence analysisAdd
BLAST

Sequence similaritiesi

Contains 7 WD repeats.PROSITE-ProRule annotation

Keywords - Domaini

Coiled coil, Repeat, WD repeat

Phylogenomic databases

eggNOGiENOG410INWU. Eukaryota.
ENOG410XRA2. LUCA.
GeneTreeiENSGT00840000129797.
HOVERGENiHBG086482.
InParanoidiQ8N0X2.
OMAiEGHNHAV.
OrthoDBiEOG7BKCTD.
PhylomeDBiQ8N0X2.
TreeFamiTF351566.

Family and domain databases

Gene3Di2.130.10.10. 1 hit.
InterProiIPR020472. G-protein_beta_WD-40_rep.
IPR015943. WD40/YVTN_repeat-like_dom.
IPR001680. WD40_repeat.
IPR019775. WD40_repeat_CS.
IPR017986. WD40_repeat_dom.
[Graphical view]
PfamiPF00400. WD40. 5 hits.
[Graphical view]
PRINTSiPR00320. GPROTEINBRPT.
SMARTiSM00320. WD40. 7 hits.
[Graphical view]
SUPFAMiSSF50978. SSF50978. 1 hit.
PROSITEiPS00678. WD_REPEATS_1. 3 hits.
PS50082. WD_REPEATS_2. 5 hits.
PS50294. WD_REPEATS_REGION. 1 hit.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8N0X2-1) [UniParc]FASTAAdd to basket

Also known as: PF20 variant 1a

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAAQRGMPSS AVRVLEEALG MGLTAAGDAR DTADAVAAEG AYYLEQVTIT
60 70 80 90 100
EASEDDYEYE EIPDDNFSIP EGEEDLAKAI QMAQEQATDT EILERKTVLP
110 120 130 140 150
SKHAVPEVIE DFLCNFLIKM GMTRTLDCFQ SEWYELIQKG VTELRTVGNV
160 170 180 190 200
PDVYTQIMLL ENENKNLKKD LKHYKQAADK AREDLLKIQK ERDFHRMHHK
210 220 230 240 250
RIVQEKNKLI NDLKGLKLHY ASYEPTIRVL HEKHHTLLKE KMLTSLERDK
260 270 280 290 300
VVGQISGLQE TLKKLQRGHS YHGPQIKVDH SREKENAPEG PTQKGLREAR
310 320 330 340 350
EQNKCKTKMK GNTKDSEFPI DMQPNPNLNV SKESLSPAKF DYKLKNIFRL
360 370 380 390 400
HELPVSCVSM QPHKDILVSC GEDRLWKVLG LPKCNVLLTG FGHTDWLSDC
410 420 430 440 450
CFHPSGDKLA TSSGDTTVKL WDLCKGDCIL TFEGHSRAVW SCTWHSCGNF
460 470 480 490 500
VASSSLDKTS KIWDVNSERC RCTLYGHTDS VNSIEFFPFS NTLLTSSADK
510 520 530 540 550
TLSIWDARTG ICEQSLYGHM HSINDAIFDP RGHMIASCDA CGVTKLWDFR
560 570 580 590 600
KLLPIVSIDI GPSPGNEVNF DSSGRVLAQA SGNGVIHLLD LKSGEIHKLM
610 620 630
GHENEAHTVV FSHDGEILFS GGSDGTVRTW S
Length:631
Mass (Da):70,818
Last modified:March 6, 2007 - v2
Checksum:i9722B49AC8FFA31C
GO
Isoform 2 (identifier: Q8N0X2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-149: Missing.
     150-179: VPDVYTQIMLLENENKNLKKDLKHYKQAAD → MTILASQKVKKIWQKQFRWPKNRLQILKFC
     574-631: GRVLAQASGN...GSDGTVRTWS → ENTTYLYRPGAQIYYFQLS

Note: No experimental confirmation available.
Show »
Length:443
Mass (Da):50,723
Checksum:iFA57EAE062D2673F
GO
Isoform 3 (identifier: Q8N0X2-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-61: MAAQRGMPSS...ASEDDYEYEE → MGVGTKARASHWRRLLSLGATPEEPLLDFK
     278-282: VDHSR → GKGCM
     283-631: Missing.

Note: No experimental confirmation available.
Show »
Length:251
Mass (Da):29,043
Checksum:iCA7894259AAC9435
GO
Isoform 4 (identifier: Q8N0X2-4) [UniParc]FASTAAdd to basket

Also known as: PF20 variant 2a

The sequence of this isoform differs from the canonical sequence as follows:
     179-183: DKARE → EYVIF
     184-631: Missing.

Show »
Length:183
Mass (Da):20,552
Checksum:iEB7B529BD49372DE
GO
Isoform 5 (identifier: Q8N0X2-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     315-347: DSEFPIDMQPNPNLNVSKESLSPAKFDYKLKNI → QWTGNSQTWNKTVPLQDTIGRRQENNSAHQHID
     348-631: Missing.

Note: No experimental confirmation available.
Show »
Length:347
Mass (Da):39,739
Checksum:i27DEB4C39B9F4CF4
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti49 – 491I → T in CAG33640 (Ref. 4) Curated
Sequence conflicti100 – 1001P → L in CAG33640 (Ref. 4) Curated
Sequence conflicti173 – 1731H → Q in CAG33640 (Ref. 4) Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti324 – 3241P → T.
Corresponds to variant rs10167688 [ dbSNP | Ensembl ].
VAR_053418
Natural varianti361 – 3611Q → H.1 Publication
Corresponds to variant rs2042791 [ dbSNP | Ensembl ].
VAR_022366
Natural varianti425 – 4251K → T.2 Publications
Corresponds to variant rs12623569 [ dbSNP | Ensembl ].
VAR_022367

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 149149Missing in isoform 2. 1 PublicationVSP_013494Add
BLAST
Alternative sequencei1 – 6161MAAQR…YEYEE → MGVGTKARASHWRRLLSLGA TPEEPLLDFK in isoform 3. 1 PublicationVSP_013493Add
BLAST
Alternative sequencei150 – 17930VPDVY…KQAAD → MTILASQKVKKIWQKQFRWP KNRLQILKFC in isoform 2. 1 PublicationVSP_013495Add
BLAST
Alternative sequencei179 – 1835DKARE → EYVIF in isoform 4. 4 PublicationsVSP_013496
Alternative sequencei184 – 631448Missing in isoform 4. 4 PublicationsVSP_013497Add
BLAST
Alternative sequencei278 – 2825VDHSR → GKGCM in isoform 3. 1 PublicationVSP_013498
Alternative sequencei283 – 631349Missing in isoform 3. 1 PublicationVSP_013499Add
BLAST
Alternative sequencei315 – 34733DSEFP…KLKNI → QWTGNSQTWNKTVPLQDTIG RRQENNSAHQHID in isoform 5. 1 PublicationVSP_013500Add
BLAST
Alternative sequencei348 – 631284Missing in isoform 5. 1 PublicationVSP_013501Add
BLAST
Alternative sequencei574 – 63158GRVLA…VRTWS → ENTTYLYRPGAQIYYFQLS in isoform 2. 1 PublicationVSP_013502Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF310672 mRNA. Translation: AAM63956.1.
AF426740 mRNA. Translation: AAN63530.1.
AF490390 mRNA. Translation: AAM97147.1.
AK026377 mRNA. Translation: BAB15466.1.
AK095036 mRNA. Translation: BAC04481.1.
CR457359 mRNA. Translation: CAG33640.1.
CR749477 mRNA. Translation: CAH18307.1.
AL832962 mRNA. Translation: CAH56274.1.
BC009614 mRNA. Translation: AAH09614.1.
BC067756 mRNA. Translation: AAH67756.1.
BC100282 mRNA. Translation: AAI00283.1.
CCDSiCCDS2396.1. [Q8N0X2-1]
CCDS46508.1. [Q8N0X2-4]
RefSeqiNP_001020607.1. NM_001025436.2. [Q8N0X2-4]
NP_078808.3. NM_024532.4. [Q8N0X2-1]
UniGeneiHs.743365.

Genome annotation databases

EnsembliENST00000331683; ENSP00000332592; ENSG00000144451. [Q8N0X2-1]
ENST00000432529; ENSP00000415079; ENSG00000144451. [Q8N0X2-4]
GeneIDi79582.
KEGGihsa:79582.
UCSCiuc002veo.5. human. [Q8N0X2-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF310672 mRNA. Translation: AAM63956.1.
AF426740 mRNA. Translation: AAN63530.1.
AF490390 mRNA. Translation: AAM97147.1.
AK026377 mRNA. Translation: BAB15466.1.
AK095036 mRNA. Translation: BAC04481.1.
CR457359 mRNA. Translation: CAG33640.1.
CR749477 mRNA. Translation: CAH18307.1.
AL832962 mRNA. Translation: CAH56274.1.
BC009614 mRNA. Translation: AAH09614.1.
BC067756 mRNA. Translation: AAH67756.1.
BC100282 mRNA. Translation: AAI00283.1.
CCDSiCCDS2396.1. [Q8N0X2-1]
CCDS46508.1. [Q8N0X2-4]
RefSeqiNP_001020607.1. NM_001025436.2. [Q8N0X2-4]
NP_078808.3. NM_024532.4. [Q8N0X2-1]
UniGeneiHs.743365.

3D structure databases

ProteinModelPortaliQ8N0X2.
SMRiQ8N0X2. Positions 284-631.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi122726. 1 interaction.
IntActiQ8N0X2. 1 interaction.
STRINGi9606.ENSP00000332592.

PTM databases

iPTMnetiQ8N0X2.
PhosphoSiteiQ8N0X2.

Polymorphism and mutation databases

BioMutaiSPAG16.
DMDMi146329993.

Proteomic databases

PaxDbiQ8N0X2.
PRIDEiQ8N0X2.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000331683; ENSP00000332592; ENSG00000144451. [Q8N0X2-1]
ENST00000432529; ENSP00000415079; ENSG00000144451. [Q8N0X2-4]
GeneIDi79582.
KEGGihsa:79582.
UCSCiuc002veo.5. human. [Q8N0X2-1]

Organism-specific databases

CTDi79582.
GeneCardsiSPAG16.
H-InvDBHIX0021055.
HGNCiHGNC:23225. SPAG16.
HPAiHPA037542.
MIMi612173. gene.
neXtProtiNX_Q8N0X2.
PharmGKBiPA134887898.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410INWU. Eukaryota.
ENOG410XRA2. LUCA.
GeneTreeiENSGT00840000129797.
HOVERGENiHBG086482.
InParanoidiQ8N0X2.
OMAiEGHNHAV.
OrthoDBiEOG7BKCTD.
PhylomeDBiQ8N0X2.
TreeFamiTF351566.

Enzyme and pathway databases

SignaLinkiQ8N0X2.

Miscellaneous databases

ChiTaRSiSPAG16. human.
GenomeRNAii79582.
NextBioi68570.
PROiQ8N0X2.
SOURCEiSearch...

Gene expression databases

BgeeiQ8N0X2.
CleanExiHS_SPAG16.
ExpressionAtlasiQ8N0X2. baseline and differential.
GenevisibleiQ8N0X2. HS.

Family and domain databases

Gene3Di2.130.10.10. 1 hit.
InterProiIPR020472. G-protein_beta_WD-40_rep.
IPR015943. WD40/YVTN_repeat-like_dom.
IPR001680. WD40_repeat.
IPR019775. WD40_repeat_CS.
IPR017986. WD40_repeat_dom.
[Graphical view]
PfamiPF00400. WD40. 5 hits.
[Graphical view]
PRINTSiPR00320. GPROTEINBRPT.
SMARTiSM00320. WD40. 7 hits.
[Graphical view]
SUPFAMiSSF50978. SSF50978. 1 hit.
PROSITEiPS00678. WD_REPEATS_1. 3 hits.
PS50082. WD_REPEATS_2. 5 hits.
PS50294. WD_REPEATS_REGION. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Isolation and expression of the human hPF20 gene orthologous to Chlamydomonas PF20: evaluation as a candidate for axonemal defects of respiratory cilia and sperm flagella."
    Pennarun G., Bridoux A.-M., Escudier E., Dastot-Le Moal F., Cacheux V., Amselem S., Duriez B.
    Am. J. Respir. Cell Mol. Biol. 26:362-370(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 4), ALTERNATIVE SPLICING, VARIANTS HIS-361 AND THR-425, TISSUE SPECIFICITY.
    Tissue: Small intestine and Testis.
  2. "A sperm-associated WD repeat protein orthologous to Chlamydomonas PF20 associates with Spag6, the mammalian orthologue of Chlamydomonas PF16."
    Zhang Z., Sapiro R., Kapfhamer D., Bucan M., Bray J., Chennathukuzhi V., McNamara P., Curtis A., Zhang M., Blanchette-Mackie E.J., Strauss J.F. III
    Mol. Cell. Biol. 22:7993-8004(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANT THR-425, TISSUE SPECIFICITY.
  3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3 AND 4).
    Tissue: Hippocampus and Small intestine.
  4. "Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201)."
    Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
    Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4).
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 5).
    Tissue: Stomach and Testis.
  6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4).
    Tissue: Brain and Pancreas.

Entry informationi

Entry nameiSPG16_HUMAN
AccessioniPrimary (citable) accession number: Q8N0X2
Secondary accession number(s): Q498B7
, Q658W1, Q68DB3, Q6I9Z6, Q8N9C7, Q9H601
Entry historyi
Integrated into UniProtKB/Swiss-Prot: April 26, 2005
Last sequence update: March 6, 2007
Last modified: May 11, 2016
This is version 126 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.