Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

IQ domain-containing protein K

Gene

IQCK

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 2 out of 5-Experimental evidence at transcript leveli

Names & Taxonomyi

Protein namesi
Recommended name:
IQ domain-containing protein K
Gene namesi
Name:IQCK
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 16

Organism-specific databases

HGNCiHGNC:28556. IQCK.

Pathology & Biotechi

Organism-specific databases

DisGeNETi124152.
OpenTargetsiENSG00000174628.
PharmGKBiPA145148697.

Polymorphism and mutation databases

BioMutaiIQCK.
DMDMi74728470.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002825741 – 287IQ domain-containing protein KAdd BLAST287

Proteomic databases

PaxDbiQ8N0W5.
PeptideAtlasiQ8N0W5.
PRIDEiQ8N0W5.

PTM databases

iPTMnetiQ8N0W5.
PhosphoSitePlusiQ8N0W5.

Expressioni

Gene expression databases

BgeeiENSG00000174628.
CleanExiHS_IQCK.
ExpressionAtlasiQ8N0W5. baseline and differential.
GenevisibleiQ8N0W5. HS.

Organism-specific databases

HPAiHPA026792.
HPA048786.

Interactioni

Protein-protein interaction databases

BioGridi125852. 1 interactor.
STRINGi9606.ENSP00000324901.

Structurei

3D structure databases

ProteinModelPortaliQ8N0W5.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Phylogenomic databases

eggNOGiENOG410IK7E. Eukaryota.
ENOG4111M9I. LUCA.
GeneTreeiENSGT00390000007907.
HOGENOMiHOG000059665.
HOVERGENiHBG104093.
InParanoidiQ8N0W5.
OMAiQHPRPPI.
OrthoDBiEOG091G0R7I.
PhylomeDBiQ8N0W5.
TreeFamiTF336038.

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8N0W5-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAAPRQIPSH IVRLKPSCST DSSFTRTPVP TVSLASRELP VSSWQVTEPS
60 70 80 90 100
SKNLWEQICK EYEAEQPPFP EGYKVKQEPV ITVAPVEEML FHGFSAEHYF
110 120 130 140 150
PVSHFTMISR TPCPQDKSET INPKTCSPKE YLETFIFPVL LPGMASLLHQ
160 170 180 190 200
AKKEKCFERK RTKFIACDFL TEWLYNQNPK RAGEPFTEFF SIPFVEERLK
210 220 230 240 250
QHPRPPIPLS LLLTEEEAAL YIQSFWRACV VRCDPEIQEL RQWQKKLREA
260 270 280
KHIHQQVKIF WAKQEQKVKC KMEDDAVPAA KMKIPSS
Length:287
Mass (Da):33,292
Last modified:October 1, 2002 - v1
Checksum:iE921F546356BCFD8
GO
Isoform 2 (identifier: Q8N0W5-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     159-189: RKRTKFIACDFLTEWLYNQNPKRAGEPFTEF → PTAANPTLAPADRRGSSPLHSILLESLCGSL
     190-287: Missing.

Show »
Length:189
Mass (Da):21,025
Checksum:i5FAAACB9D1C21BBC
GO
Isoform 3 (identifier: Q8N0W5-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     159-209: RKRTKFIACD...KQHPRPPIPL → VSCLAGFLYF...GHLPSSSHTI
     210-287: Missing.

Note: Gene prediction based on EST data. No experimental confirmation available.
Show »
Length:212
Mass (Da):23,800
Checksum:i12C891B7F2704477
GO

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_031416220L → P.Corresponds to variant rs7191155dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_024204159 – 209RKRTK…PPIPL → VSCLAGFLYFEILNHSLLSD DSSLSWYHQVVLQMTPSGGK ACVWGHLPSSSHTI in isoform 3. CuratedAdd BLAST51
Alternative sequenceiVSP_024205159 – 189RKRTK…PFTEF → PTAANPTLAPADRRGSSPLH SILLESLCGSL in isoform 2. 1 PublicationAdd BLAST31
Alternative sequenceiVSP_024206190 – 287Missing in isoform 2. 1 PublicationAdd BLAST98
Alternative sequenceiVSP_024207210 – 287Missing in isoform 3. CuratedAdd BLAST78

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF520569 mRNA. Translation: AAM77339.1.
AF520570 mRNA. Translation: AAM77340.1.
AK315672 mRNA. Translation: BAG38037.1.
AC002550 Genomic DNA. Translation: AAC05807.1.
CH471186 Genomic DNA. Translation: EAW50300.1.
BC034823 mRNA. Translation: AAH34823.1.
CCDSiCCDS10580.1. [Q8N0W5-1]
RefSeqiNP_001292050.1. NM_001305121.1.
NP_001292051.1. NM_001305122.1.
NP_694940.1. NM_153208.2. [Q8N0W5-1]
XP_016878422.1. XM_017022933.1. [Q8N0W5-1]
UniGeneiHs.460217.
Hs.656664.

Genome annotation databases

EnsembliENST00000308214; ENSP00000309261; ENSG00000174628. [Q8N0W5-2]
ENST00000320394; ENSP00000324901; ENSG00000174628. [Q8N0W5-1]
GeneIDi124152.
KEGGihsa:124152.
UCSCiuc002dgr.4. human. [Q8N0W5-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF520569 mRNA. Translation: AAM77339.1.
AF520570 mRNA. Translation: AAM77340.1.
AK315672 mRNA. Translation: BAG38037.1.
AC002550 Genomic DNA. Translation: AAC05807.1.
CH471186 Genomic DNA. Translation: EAW50300.1.
BC034823 mRNA. Translation: AAH34823.1.
CCDSiCCDS10580.1. [Q8N0W5-1]
RefSeqiNP_001292050.1. NM_001305121.1.
NP_001292051.1. NM_001305122.1.
NP_694940.1. NM_153208.2. [Q8N0W5-1]
XP_016878422.1. XM_017022933.1. [Q8N0W5-1]
UniGeneiHs.460217.
Hs.656664.

3D structure databases

ProteinModelPortaliQ8N0W5.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi125852. 1 interactor.
STRINGi9606.ENSP00000324901.

PTM databases

iPTMnetiQ8N0W5.
PhosphoSitePlusiQ8N0W5.

Polymorphism and mutation databases

BioMutaiIQCK.
DMDMi74728470.

Proteomic databases

PaxDbiQ8N0W5.
PeptideAtlasiQ8N0W5.
PRIDEiQ8N0W5.

Protocols and materials databases

DNASUi124152.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000308214; ENSP00000309261; ENSG00000174628. [Q8N0W5-2]
ENST00000320394; ENSP00000324901; ENSG00000174628. [Q8N0W5-1]
GeneIDi124152.
KEGGihsa:124152.
UCSCiuc002dgr.4. human. [Q8N0W5-1]

Organism-specific databases

CTDi124152.
DisGeNETi124152.
GeneCardsiIQCK.
HGNCiHGNC:28556. IQCK.
HPAiHPA026792.
HPA048786.
neXtProtiNX_Q8N0W5.
OpenTargetsiENSG00000174628.
PharmGKBiPA145148697.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IK7E. Eukaryota.
ENOG4111M9I. LUCA.
GeneTreeiENSGT00390000007907.
HOGENOMiHOG000059665.
HOVERGENiHBG104093.
InParanoidiQ8N0W5.
OMAiQHPRPPI.
OrthoDBiEOG091G0R7I.
PhylomeDBiQ8N0W5.
TreeFamiTF336038.

Miscellaneous databases

ChiTaRSiIQCK. human.
GenomeRNAii124152.
PROiQ8N0W5.

Gene expression databases

BgeeiENSG00000174628.
CleanExiHS_IQCK.
ExpressionAtlasiQ8N0W5. baseline and differential.
GenevisibleiQ8N0W5. HS.

Family and domain databases

ProtoNetiSearch...

Entry informationi

Entry nameiIQCK_HUMAN
AccessioniPrimary (citable) accession number: Q8N0W5
Secondary accession number(s): B2RDU0, O43327, Q8NFF4
Entry historyi
Integrated into UniProtKB/Swiss-Prot: April 3, 2007
Last sequence update: October 1, 2002
Last modified: November 2, 2016
This is version 99 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 16
    Human chromosome 16: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.