Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

L-fucose kinase

Gene

FUK

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at transcript leveli

Functioni

Takes part in the salvage pathway for reutilization of fucose from the degradation of oligosaccharides.

Catalytic activityi

ATP + L-fucose = ADP + beta-L-fucose 1-phosphate.

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Nucleotide bindingi834 – 845ATPSequence analysisAdd BLAST12

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionKinase, Transferase
LigandATP-binding, Nucleotide-binding

Enzyme and pathway databases

BRENDAi2.7.1.52. 2681.
ReactomeiR-HSA-6787639. GDP-fucose biosynthesis.

Names & Taxonomyi

Protein namesi
Recommended name:
L-fucose kinase (EC:2.7.1.52)
Short name:
Fucokinase
Gene namesi
Name:FUK
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 16

Organism-specific databases

EuPathDBiHostDB:ENSG00000157353.16.
HGNCiHGNC:29500. FUK.

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000157353.
PharmGKBiPA134863646.

Polymorphism and mutation databases

BioMutaiFUK.
DMDMi73915340.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001566721 – 1084L-fucose kinaseAdd BLAST1084

Proteomic databases

EPDiQ8N0W3.
MaxQBiQ8N0W3.
PaxDbiQ8N0W3.
PeptideAtlasiQ8N0W3.
PRIDEiQ8N0W3.

PTM databases

iPTMnetiQ8N0W3.
PhosphoSitePlusiQ8N0W3.

Expressioni

Gene expression databases

BgeeiENSG00000157353.
CleanExiHS_FUK.
ExpressionAtlasiQ8N0W3. baseline and differential.
GenevisibleiQ8N0W3. HS.

Organism-specific databases

HPAiHPA041971.

Interactioni

Protein-protein interaction databases

BioGridi128243. 5 interactors.
STRINGi9606.ENSP00000288078.

Structurei

3D structure databases

ProteinModelPortaliQ8N0W3.
SMRiQ8N0W3.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the GHMP kinase family.Curated

Phylogenomic databases

eggNOGiKOG4644. Eukaryota.
ENOG4111FB6. LUCA.
GeneTreeiENSGT00390000002251.
HOGENOMiHOG000294126.
HOVERGENiHBG021773.
InParanoidiQ8N0W3.
KOiK05305.
OMAiCLLEGPV.
OrthoDBiEOG091G04JR.
PhylomeDBiQ8N0W3.
TreeFamiTF314554.

Family and domain databases

Gene3Di3.30.230.10. 1 hit.
3.30.70.890. 1 hit.
InterProiView protein in InterPro
IPR012887. Fucokinase.
IPR013750. GHMP_kinase_C_dom.
IPR036554. GHMP_kinase_C_sf.
IPR006204. GHMP_kinase_N_dom.
IPR020568. Ribosomal_S5_D2-typ_fold.
IPR014721. Ribosomal_S5_D2-typ_fold_subgr.
PfamiView protein in Pfam
PF07959. Fucokinase. 1 hit.
PF08544. GHMP_kinases_C. 1 hit.
PF00288. GHMP_kinases_N. 1 hit.
SUPFAMiSSF54211. SSF54211. 1 hit.
SSF55060. SSF55060. 1 hit.

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8N0W3-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MEQPKGVDWT VIILTCQYKD SVQVFQRELE VRQKREQIPA GTLLLAVEDP
60 70 80 90 100
EKRVGSGGAT LNALLVAAEH LSARAGFTVV TSDVLHSAWI LILHMGRDFP
110 120 130 140 150
FDDCGRAFTC LPVENPEAPV EALVCNLDCL LDIMTYRLGP GSPPGVWVCS
160 170 180 190 200
TDMLLSVPAN PGISWDSFRG ARVIALPGSP AYAQNHGVYL TDPQGLVLDI
210 220 230 240 250
YYQGTEAEIQ RCVRPDGRVP LVSGVVFFSV ETAERLLATH VSPPLDACTY
260 270 280 290 300
LGLDSGARPV QLSLFFDILH CMAENVTRED FLVGRPPELG QGDADVAGYL
310 320 330 340 350
QSARAQLWRE LRDQPLTMAY VSSGSYSYMT SSASEFLLSL TLPGAPGAQI
360 370 380 390 400
VHSQVEEQQL LAAGSSVVSC LLEGPVQLGP GSVLQHCHLQ GPIHIGAGCL
410 420 430 440 450
VTGLDTAHSK ALHGRELRDL VLQGHHTRLH GSPGHAFTLV GRLDSWERQG
460 470 480 490 500
AGTYLNVPWS EFFKRTGVRA WDLWDPETLP AEYCLPSARL FPVLHPSREL
510 520 530 540 550
GPQDLLWMLD HQEDGGEALR AWRASWRLSW EQLQPCLDRA ATLASRRDLF
560 570 580 590 600
FRQALHKARH VLEARQDLSL RPLIWAAVRE GCPGPLLATL DQVAAGAGDP
610 620 630 640 650
GVAARALACV ADVLGCMAEG RGGLRSGPAA NPEWMRPFSY LECGDLAAGV
660 670 680 690 700
EALAQERDKW LSRPALLVRA ARHYEGAGQI LIRQAVMSAQ HFVSTEQVEL
710 720 730 740 750
PGPGQWVVAE CPARVDFSGG WSDTPPLAYE LGGAVLGLAV RVDGRRPIGA
760 770 780 790 800
RARRIPEPEL WLAVGPRQDE MTVKIVCRCL ADLRDYCQPH APGALLKAAF
810 820 830 840 850
ICAGIVHVHS ELQLSEQLLR TFGGGFELHT WSELPHGSGL GTSSILAGTA
860 870 880 890 900
LAALQRAAGR VVGTEALIHA VLHLEQVLTT GGGWQDQVGG LMPGIKVGRS
910 920 930 940 950
RAQLPLKVEV EEVTVPEGFV QKLNDHLLLV YTGKTRLARN LLQDVLRSWY
960 970 980 990 1000
ARLPAVVQNA HSLVRQTEEC AEGFRQGSLP LLGQCLTSYW EQKKLMAPGC
1010 1020 1030 1040 1050
EPLTVRRMMD VLAPHVHGQS LAGAGGGGFL YLLTKEPQQK EALEAVLAKT
1060 1070 1080
EGLGNYSIHL VEVDTQGLSL KLLGTEASTC CPFP
Length:1,084
Mass (Da):117,623
Last modified:August 30, 2005 - v2
Checksum:i153F91882F4B143C
GO
Isoform 2 (identifier: Q8N0W3-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     78-78: T → TWICVGVSLWIRGCHPPGRLPEASVHRAFPLLQ
     816-841: Missing.

Note: No experimental confirmation available.
Show »
Length:1,090
Mass (Da):118,393
Checksum:i8522A425A0832887
GO

Sequence cautioni

Q8N0W3: The sequence BAB71190 differs from that shown. Reason: Frameshift at position 19.Curated
Q8N0W3: The sequence CAD29647 differs from that shown. Reason: Frameshift at position 19.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti400L → S in BAB71190 (PubMed:14702039).Curated1
Sequence conflicti609C → R in BAB71190 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_021327146V → M1 PublicationCorresponds to variant dbSNP:rs17881323Ensembl.1
Natural variantiVAR_021328521A → T1 PublicationCorresponds to variant dbSNP:rs17881069Ensembl.1
Natural variantiVAR_021329571R → H1 PublicationCorresponds to variant dbSNP:rs17886171Ensembl.1
Natural variantiVAR_021330701P → L1 PublicationCorresponds to variant dbSNP:rs17883716Ensembl.1
Natural variantiVAR_021331858A → T1 PublicationCorresponds to variant dbSNP:rs17884050Ensembl.1
Natural variantiVAR_021332861V → M1 PublicationCorresponds to variant dbSNP:rs17878599Ensembl.1
Natural variantiVAR_021333901R → W1 PublicationCorresponds to variant dbSNP:rs17881635Ensembl.1
Natural variantiVAR_021334939R → Q1 PublicationCorresponds to variant dbSNP:rs17886060Ensembl.1
Natural variantiVAR_021335939R → W1 PublicationCorresponds to variant dbSNP:rs17883248Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_01542278T → TWICVGVSLWIRGCHPPGRL PEASVHRAFPLLQ in isoform 2. 1 Publication1
Alternative sequenceiVSP_015423816 – 841Missing in isoform 2. 1 PublicationAdd BLAST26

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ441184 mRNA. Translation: CAD29647.1. Frameshift.
AK056456 mRNA. Translation: BAB71190.1. Frameshift.
AK128387 mRNA. Translation: BAC87413.1.
AY829643 Genomic DNA. Translation: AAV67949.1.
BC013735 mRNA. Translation: AAH13735.1.
BC032542 mRNA. Translation: AAH32542.2.
CCDSiCCDS10891.2. [Q8N0W3-1]
PIRiJC7878.
RefSeqiNP_659496.2. NM_145059.2. [Q8N0W3-1]
XP_011521230.1. XM_011522928.1. [Q8N0W3-1]
XP_011521231.1. XM_011522929.1. [Q8N0W3-1]
XP_016878501.1. XM_017023012.1. [Q8N0W3-1]
UniGeneiHs.7907.

Genome annotation databases

EnsembliENST00000288078; ENSP00000288078; ENSG00000157353. [Q8N0W3-1]
ENST00000378912; ENSP00000368192; ENSG00000157353. [Q8N0W3-2]
GeneIDi197258.
KEGGihsa:197258.
UCSCiuc002eyy.4. human. [Q8N0W3-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiFUK_HUMAN
AccessioniPrimary (citable) accession number: Q8N0W3
Secondary accession number(s): Q5PSM3
, Q5XKL6, Q6ZRA0, Q96MT9
Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 28, 2002
Last sequence update: August 30, 2005
Last modified: October 25, 2017
This is version 129 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 16
    Human chromosome 16: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families