Q8N0W3 (FUK_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 84.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: L-fucose kinase Short name=Fucokinase EC=2.7.1.52 | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 1084 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Function | Takes part in the salvage pathway for reutilization of fucose from the degradation of oligosaccharides. |
| Catalytic activity | ATP + L-fucose = ADP + beta-L-fucose 1-phosphate. |
| Sequence similarities | Belongs to the GHMP kinase family. |
| Sequence caution | The sequence BAB71190.1 differs from that shown. Reason: Frameshift at position 19. The sequence CAD29647.1 differs from that shown. Reason: Frameshift at position 19. |
Ontologies
| Keywords | |
|---|---|
| Coding sequence diversity | Alternative splicing Polymorphism |
| Ligand | ATP-binding Nucleotide-binding |
| Molecular function | Kinase Transferase |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Cellular component | cytoplasm Inferred from electronic annotation. Source: InterPro |
| Molecular function | ATP binding Inferred from electronic annotation. Source: UniProtKB-KW fucokinase activityNon-traceable author statement Ref.1. Source: UniProtKB |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q8N0W3-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q8N0W3-2) The sequence of this isoform differs from the canonical sequence as follows: 78-78: T → TWICVGVSLWIRGCHPPGRLPEASVHRAFPLLQ 816-841: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1084 | 1084 | L-fucose kinase | PRO_0000156672 | |||||
Regions | |||||||||
| Nucleotide binding | 834 – 845 | 12 | ATP Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 78 | 1 | T → TWICVGVSLWIRGCHPPGRL PEASVHRAFPLLQ in isoform 2. | VSP_015422 | |||||
| Alternative sequence | 816 – 841 | 26 | Missing in isoform 2. | VSP_015423 | |||||
| Natural variant | 146 | 1 | V → M. Ref.3 Corresponds to variant rs17881323 [ dbSNP | Ensembl ]. | VAR_021327 | |||||
| Natural variant | 521 | 1 | A → T. Ref.3 Corresponds to variant rs17881069 [ dbSNP | Ensembl ]. | VAR_021328 | |||||
| Natural variant | 571 | 1 | R → H. Ref.3 Corresponds to variant rs17886171 [ dbSNP | Ensembl ]. | VAR_021329 | |||||
| Natural variant | 701 | 1 | P → L. Ref.3 Corresponds to variant rs17883716 [ dbSNP | Ensembl ]. | VAR_021330 | |||||
| Natural variant | 858 | 1 | A → T. Ref.3 Corresponds to variant rs17884050 [ dbSNP | Ensembl ]. | VAR_021331 | |||||
| Natural variant | 861 | 1 | V → M. Ref.3 Corresponds to variant rs17878599 [ dbSNP | Ensembl ]. | VAR_021332 | |||||
| Natural variant | 901 | 1 | R → W. Ref.3 Corresponds to variant rs17881635 [ dbSNP | Ensembl ]. | VAR_021333 | |||||
| Natural variant | 939 | 1 | R → Q. Ref.3 Corresponds to variant rs17886060 [ dbSNP | Ensembl ]. | VAR_021334 | |||||
| Natural variant | 939 | 1 | R → W. Ref.3 Corresponds to variant rs17883248 [ dbSNP | Ensembl ]. | VAR_021335 | |||||
Experimental info | |||||||||
| Sequence conflict | 400 | 1 | L → S in BAB71190. Ref.2 | ||||||
| Sequence conflict | 609 | 1 | C → R in BAB71190. Ref.2 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Identification of human L-fucose kinase amino acid sequence." Hinderlich S., Berger M., Blume A., Chen H., Ghaderi D., Bauer C. Biochem. Biophys. Res. Commun. 294:650-654(2002) [PubMed: 12056818] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [2] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2). Tissue: Neuron and Thymus. |
| [3] | SeattleSNPs variation discovery resource Submitted (NOV-2004) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANTS MET-146; THR-521; HIS-571; LEU-701; THR-858; MET-861; TRP-901; GLN-939 AND TRP-939. |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Brain and Uterus. |
Web resources
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AJ441184 mRNA. Translation: CAD29647.1. Frameshift. AK056456 mRNA. Translation: BAB71190.1. Frameshift. AK128387 mRNA. Translation: BAC87413.1. AY829643 Genomic DNA. Translation: AAV67949.1. BC013735 mRNA. Translation: AAH13735.1. BC032542 mRNA. Translation: AAH32542.2. |
| IPI | IPI00418741. IPI00645739. |
| PIR | JC7878. |
| RefSeq | NP_659496.2. NM_145059.2. |
| UniGene | Hs.7907. |
3D structure databases | |
| ProteinModelPortal | Q8N0W3. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | Q8N0W3. |
PTM databases | |
| PhosphoSite | Q8N0W3. |
Polymorphism databases | |
| DMDM | 73915340. |
Proteomic databases | |
| PRIDE | Q8N0W3. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000288078; ENSP00000288078; ENSG00000157353. |
| GeneID | 197258. |
| KEGG | hsa:197258. |
| NMPDR | fig|9606.3.peg.12506. |
| UCSC | uc002eyy.1. human. uc010cft.1. human. |
Organism-specific databases | |
| CTD | 197258. |
| GeneCards | GC16P070488. |
| H-InvDB | HIX0013200. |
| HGNC | HGNC:29500. FUK. |
| HPA | HPA041971. |
| MIM | 608675. gene. |
| neXtProt | NX_Q8N0W3. |
| PharmGKB | PA134863646. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | prNOG18486. |
| HOVERGEN | HBG021773. |
| OMA | WRLSWEQ. |
| PhylomeDB | Q8N0W3. |
Gene expression databases | |
| ArrayExpress | Q8N0W3. |
| Bgee | Q8N0W3. |
| CleanEx | HS_FUK. |
| Genevestigator | Q8N0W3. |
| GermOnline | ENSG00000157353. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR012887. Fucokinase. IPR006204. GHMP_kinase. IPR013750. GHMP_kinase_C. IPR006206. Mevalonate/galactokinase. IPR020568. Ribosomal_S5_D2-typ_fold. IPR014721. Ribosomal_S5_D2-typ_fold_subgr. [Graphical view] |
| Gene3D | G3DSA:3.30.230.10. Ribosomal_S5_D2-type_fold. 2 hits. |
| KO | K05305. |
| Pfam | PF07959. Fucokinase. 1 hit. PF08544. GHMP_kinases_C. 1 hit. PF00288. GHMP_kinases_N. 1 hit. [Graphical view] |
| PRINTS | PR00959. MEVGALKINASE. |
| SUPFAM | SSF54211. Ribosomal_S5_D2-typ_fold. 1 hit. |
| PROSITE | PS00627. GHMP_KINASES_ATP. False negative. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 89626. |
| SOURCE | Search... |
Entry information
| Entry name | FUK_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q8N0W3 Secondary accession number(s): Q5PSM3 Q96MT9 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 16 Human chromosome 16: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with