Reviewed,
UniProtKB/Swiss-Prot Q8N0W3 (FUK_HUMAN)
Last modified
June 16, 2009.
Version 62.
History...
Clusters with 100%,
90%,
50% identity |
Documents (5) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: L-fucose kinase Short name=Fucokinase EC=2.7.1.52 | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 1084 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at transcript level. |
General annotation (Comments)
| Function | Takes part in the salvage pathway for reutilization of fucose from the degradation of oligosaccharides. |
| Catalytic activity | ATP + L-fucose = ADP + beta-L-fucose 1-phosphate. |
| Sequence similarities | Belongs to the GHMP kinase family. |
| Sequence caution | The sequence BAB71190.1 differs from that shown. Reason: Frameshift at position 19. The sequence CAD29647.1 differs from that shown. Reason: Frameshift at position 19. |
Ontologies
| Keywords | |
|---|---|
| Coding sequence diversity | Alternative splicing Polymorphism |
| Ligand | ATP-binding Nucleotide-binding |
| Molecular function | Kinase Transferase |
| Gene Ontology (GO) | |
| Biological process | phosphorylation Inferred from electronic annotation. Source: InterPro |
| Cellular component | cytoplasm Inferred from electronic annotation. Source: InterPro |
| Molecular function | ATP binding Inferred from electronic annotation. Source: UniProtKB-KW fucokinase activity Ref.1Non-traceable author statement. Source: UniProtKB |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q8N0W3-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q8N0W3-2) The sequence of this isoform differs from the canonical sequence as follows: 78-78: T → TWICVGVSLWIRGCHPPGRLPEASVHRAFPLLQ 816-841: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1084 | 1084 | L-fucose kinase | PRO_0000156672 | |||||
Regions | |||||||||
| Nucleotide binding | 834 – 845 | 12 | ATP Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 78 | 1 | T → TWICVGVSLWIRGCHPPGRL PEASVHRAFPLLQ in isoform 2. | VSP_015422 | |||||
| Alternative sequence | 816 – 841 | 26 | Missing in isoform 2. | VSP_015423 | |||||
| Natural variant | 146 | 1 | V → M Ref.3 | VAR_021327 | |||||
| Natural variant | 521 | 1 | A → T: dbSNP rs17881069. Ref.3 | VAR_021328 | |||||
| Natural variant | 571 | 1 | R → H: dbSNP rs17886171. Ref.3 | VAR_021329 | |||||
| Natural variant | 701 | 1 | P → L Ref.3 | VAR_021330 | |||||
| Natural variant | 858 | 1 | A → T Ref.3 | VAR_021331 | |||||
| Natural variant | 861 | 1 | V → M: dbSNP rs17878599. Ref.3 | VAR_021332 | |||||
| Natural variant | 901 | 1 | R → W Ref.3 | VAR_021333 | |||||
| Natural variant | 939 | 1 | R → Q Ref.3 | VAR_021334 | |||||
| Natural variant | 939 | 1 | R → W Ref.3 | VAR_021335 | |||||
Experimental info | |||||||||
| Sequence conflict | 400 | 1 | L → S in BAB71190. Ref.2 | ||||||
| Sequence conflict | 609 | 1 | C → R in BAB71190. Ref.2 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Identification of human L-fucose kinase amino acid sequence." Hinderlich S., Berger M., Blume A., Chen H., Ghaderi D., Bauer C. Biochem. Biophys. Res. Commun. 294:650-654(2002) [PubMed: 12056818] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [2] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2). Tissue: Neuron and Thymus. |
| [3] | SeattleSNPs variation discovery resource Submitted (NOV-2004) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANTS MET-146; THR-521; HIS-571; LEU-701; THR-858; MET-861; TRP-901; GLN-939 AND TRP-939. |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Brain and Uterus. |
Cross-references
Sequence databases | |
|---|---|
| AJ441184 mRNA. Translation: CAD29647.1. Frameshift. AK056456 mRNA. Translation: BAB71190.1. Frameshift. AK128387 mRNA. Translation: BAC87413.1. AY829643 Genomic DNA. Translation: AAV67949.1. BC013735 mRNA. Translation: AAH13735.1. BC032542 mRNA. Translation: AAH32542.2. | |
| IPI | IPI00418741. IPI00645739. |
| PIR | JC7878. |
| RefSeq | NP_659496.2. |
| UniGene | Hs.7907 |
3D structure databases | |
| ModBase | Search... |
PTM databases | |
| PhosphoSite | Q8N0W3. |
Proteomic databases | |
| PRIDE | Q8N0W3. |
Genome annotation databases | |
| Ensembl | ENSG00000157353. Homo sapiens. [Contig view] |
| GeneID | 197258. |
| KEGG | hsa:197258. |
| NMPDR | fig|9606.3.peg.12506. |
Organism-specific databases | |
| GeneCards | GC16P069045. |
| H-InvDB | HIX0013200. |
| HGNC | HGNC:29500. FUK. |
| MIM | 608675. gene. |
| PharmGKB | PA134863646. |
| GenAtlas | Search... |
Phylogenomic databases | |
| HOVERGEN | Q8N0W3. |
| OMA | Q8N0W3. ARVDFSG. |
Enzyme and pathway databases | |
| BRENDA | 2.7.1.52. 247. |
Gene expression databases | |
| ArrayExpress | Q8N0W3. |
| Bgee | Q8N0W3. |
| CleanEx | HS_FUK. |
| GermOnline | ENSG00000157353. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR012887. Fucokinase. IPR006204. GHMP_kinase. IPR013750. GHMP_kinase_C. IPR006203. GHMP_knse_ATP_bd_CS. IPR006206. Mev_galkinase. [Graphical view] |
| Pfam | PF07959. Fucokinase. 1 hit. PF08544. GHMP_kinases_C. 1 hit. PF00288. GHMP_kinases_N. 1 hit. [Graphical view] |
| PRINTS | PR00959. MEVGALKINASE. |
| PROSITE | PS00627. GHMP_KINASES_ATP. False negative. [Graphical view] |
| ProtoNet | Search... |
Other Resources | |
| NextBio | 89626. |
| SOURCE | Search... |
Entry information
| Entry name | FUK_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q8N0W3 Secondary accession number(s): Q5PSM3 Q96MT9 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
Relevant documents
| Human chromosome 16 Human chromosome 16: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with


