Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Centromere protein L

Gene

CENPL

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

Component of the CENPA-CAD (nucleosome distal) complex, a complex recruited to centromeres which is involved in assembly of kinetochore proteins, mitotic progression and chromosome segregation. May be involved in incorporation of newly synthesized CENPA into centromeres via its interaction with the CENPA-NAC complex.1 Publication

GO - Biological processi

Complete GO annotation...

Enzyme and pathway databases

ReactomeiR-HSA-2467813. Separation of Sister Chromatids.
R-HSA-2500257. Resolution of Sister Chromatid Cohesion.
R-HSA-5663220. RHO GTPases Activate Formins.
R-HSA-606279. Deposition of new CENPA-containing nucleosomes at the centromere.
R-HSA-68877. Mitotic Prometaphase.

Names & Taxonomyi

Protein namesi
Recommended name:
Centromere protein L
Short name:
CENP-L
Alternative name(s):
Interphase centromere complex protein 33
Gene namesi
Name:CENPL
Synonyms:C1orf155, ICEN33
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

HGNCiHGNC:17879. CENPL.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Centromere, Chromosome, Nucleus

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA142672406.

Polymorphism and mutation databases

BioMutaiCENPL.
DMDMi110832790.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 344344Centromere protein LPRO_0000247170Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei53 – 531PhosphoserineCombined sources

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ8N0S6.
MaxQBiQ8N0S6.
PRIDEiQ8N0S6.

PTM databases

iPTMnetiQ8N0S6.
PhosphoSiteiQ8N0S6.

Expressioni

Gene expression databases

BgeeiQ8N0S6.
CleanExiHS_CENPL.
ExpressionAtlasiQ8N0S6. baseline and differential.
GenevisibleiQ8N0S6. HS.

Organism-specific databases

HPAiHPA044520.

Interactioni

Subunit structurei

Component of the CENPA-CAD complex, composed of CENPI, CENPK, CENPL, CENPO, CENPP, CENPQ, CENPR and CENPS. The CENPA-CAD complex interacts with the CENPA-NAC complex, at least composed of CENPA, CENPC, CENPH, CENPM, CENPN, CENPT and CENPU.1 Publication

Binary interactionsi

WithEntry#Exp.IntActNotes
FAM9BQ8IZU03EBI-8467109,EBI-10175124

Protein-protein interaction databases

BioGridi124865. 11 interactions.
IntActiQ8N0S6. 3 interactions.
MINTiMINT-8417655.

Structurei

3D structure databases

ProteinModelPortaliQ8N0S6.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Phylogenomic databases

GeneTreeiENSGT00390000013877.
HOGENOMiHOG000111543.
HOVERGENiHBG081085.
InParanoidiQ8N0S6.
KOiK11504.
OMAiFIAAEKQ.
OrthoDBiEOG74J97Q.
PhylomeDBiQ8N0S6.
TreeFamiTF329688.

Family and domain databases

InterProiIPR025204. CENP-L.
[Graphical view]
PfamiPF13092. CENP-L. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8N0S6-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MDSYSAPEST PSASSRPEDY FIGATPLQKR LESVRKQSSF ILTPPRRKIP
60 70 80 90 100
QCSQLQEDVD PQKVAFLLHK QWTLYSLTPL YKFSYSNLKE YSRLLNAFIV
110 120 130 140 150
AEKQKGLAVE VGEDFNIKVI FSTLLGMKGT QRDPEAFLVQ IVSKSQLPSE
160 170 180 190 200
NREGKVLWTG WFCCVFGDSL LETVSEDFTC LPLFLANGAE SNTAIIGTWF
210 220 230 240 250
QKTFDCYFSP LAINAFNLSW MAAMWTACKM DHYVATTEFL WSVPCSPQSL
260 270 280 290 300
DISFAIHPED AKALWDSVHK TPGEVTQEEV DLFMDCLYSH FHRHFKIHLS
310 320 330 340
ATRLVRVSTS VASAHTDGKI KILCHKYLIG VLAYLTELAI FQIE
Length:344
Mass (Da):38,998
Last modified:July 25, 2006 - v2
Checksum:i20EB5565F392FDE2
GO
Isoform 2 (identifier: Q8N0S6-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     140-140: Q → QGLILSPRLEYSGTILVDCNLCLLGSSDPSTLAFQVAGTAGACHHTR

Note: No experimental confirmation available.
Show »
Length:390
Mass (Da):43,739
Checksum:i92F2BBED7364F0D1
GO
Isoform 3 (identifier: Q8N0S6-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     141-188: IVSKSQLPSE...TCLPLFLANG → GLILSPRLEY...ADCVKISIAI
     189-344: Missing.

Note: No experimental confirmation available.
Show »
Length:188
Mass (Da):20,886
Checksum:i7794890B0F07BE58
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti117 – 1171I → F.
Corresponds to variant rs12086855 [ dbSNP | Ensembl ].
VAR_027081

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei140 – 1401Q → QGLILSPRLEYSGTILVDCN LCLLGSSDPSTLAFQVAGTA GACHHTR in isoform 2. 1 PublicationVSP_019939
Alternative sequencei141 – 18848IVSKS…FLANG → GLILSPRLEYSGTILVDCNL CLLGSSDPSTLAFQVAGTAD CVKISIAI in isoform 3. 1 PublicationVSP_019940Add
BLAST
Alternative sequencei189 – 344156Missing in isoform 3. 1 PublicationVSP_019941Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK055606 mRNA. Translation: BAB70968.1.
AL109921 Genomic DNA. Translation: CAI20378.1.
AL109921 Genomic DNA. Translation: CAI20379.1.
BC007071 mRNA. Translation: AAH07071.1.
BC033154 mRNA. Translation: AAH33154.1.
BC066658 mRNA. Translation: AAH66658.1.
CCDSiCCDS30938.1. [Q8N0S6-1]
CCDS44277.1. [Q8N0S6-2]
RefSeqiNP_001120653.1. NM_001127181.2. [Q8N0S6-2]
NP_001164653.1. NM_001171182.1. [Q8N0S6-1]
NP_201576.1. NM_033319.3. [Q8N0S6-1]
UniGeneiHs.531856.
Hs.720473.

Genome annotation databases

EnsembliENST00000345664; ENSP00000323543; ENSG00000120334. [Q8N0S6-1]
ENST00000356198; ENSP00000348527; ENSG00000120334. [Q8N0S6-2]
ENST00000367710; ENSP00000356683; ENSG00000120334. [Q8N0S6-1]
GeneIDi91687.
KEGGihsa:91687.
UCSCiuc001gje.5. human. [Q8N0S6-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK055606 mRNA. Translation: BAB70968.1.
AL109921 Genomic DNA. Translation: CAI20378.1.
AL109921 Genomic DNA. Translation: CAI20379.1.
BC007071 mRNA. Translation: AAH07071.1.
BC033154 mRNA. Translation: AAH33154.1.
BC066658 mRNA. Translation: AAH66658.1.
CCDSiCCDS30938.1. [Q8N0S6-1]
CCDS44277.1. [Q8N0S6-2]
RefSeqiNP_001120653.1. NM_001127181.2. [Q8N0S6-2]
NP_001164653.1. NM_001171182.1. [Q8N0S6-1]
NP_201576.1. NM_033319.3. [Q8N0S6-1]
UniGeneiHs.531856.
Hs.720473.

3D structure databases

ProteinModelPortaliQ8N0S6.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi124865. 11 interactions.
IntActiQ8N0S6. 3 interactions.
MINTiMINT-8417655.

PTM databases

iPTMnetiQ8N0S6.
PhosphoSiteiQ8N0S6.

Polymorphism and mutation databases

BioMutaiCENPL.
DMDMi110832790.

Proteomic databases

EPDiQ8N0S6.
MaxQBiQ8N0S6.
PRIDEiQ8N0S6.

Protocols and materials databases

DNASUi91687.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000345664; ENSP00000323543; ENSG00000120334. [Q8N0S6-1]
ENST00000356198; ENSP00000348527; ENSG00000120334. [Q8N0S6-2]
ENST00000367710; ENSP00000356683; ENSG00000120334. [Q8N0S6-1]
GeneIDi91687.
KEGGihsa:91687.
UCSCiuc001gje.5. human. [Q8N0S6-1]

Organism-specific databases

CTDi91687.
GeneCardsiCENPL.
HGNCiHGNC:17879. CENPL.
HPAiHPA044520.
MIMi611503. gene.
neXtProtiNX_Q8N0S6.
PharmGKBiPA142672406.
GenAtlasiSearch...

Phylogenomic databases

GeneTreeiENSGT00390000013877.
HOGENOMiHOG000111543.
HOVERGENiHBG081085.
InParanoidiQ8N0S6.
KOiK11504.
OMAiFIAAEKQ.
OrthoDBiEOG74J97Q.
PhylomeDBiQ8N0S6.
TreeFamiTF329688.

Enzyme and pathway databases

ReactomeiR-HSA-2467813. Separation of Sister Chromatids.
R-HSA-2500257. Resolution of Sister Chromatid Cohesion.
R-HSA-5663220. RHO GTPases Activate Formins.
R-HSA-606279. Deposition of new CENPA-containing nucleosomes at the centromere.
R-HSA-68877. Mitotic Prometaphase.

Miscellaneous databases

GeneWikiiCENPL.
GenomeRNAii91687.
PROiQ8N0S6.
SOURCEiSearch...

Gene expression databases

BgeeiQ8N0S6.
CleanExiHS_CENPL.
ExpressionAtlasiQ8N0S6. baseline and differential.
GenevisibleiQ8N0S6. HS.

Family and domain databases

InterProiIPR025204. CENP-L.
[Graphical view]
PfamiPF13092. CENP-L. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
    Tissue: Synovial cell.
  2. "The DNA sequence and biological annotation of human chromosome 1."
    Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K.
    , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
    Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
    Tissue: Eye, Muscle and Urinary bladder.
  4. "Comprehensive analysis of the ICEN (Interphase Centromere Complex) components enriched in the CENP-A chromatin of human cells."
    Izuta H., Ikeno M., Suzuki N., Tomonaga T., Nozaki N., Obuse C., Kisu Y., Goshima N., Nomura F., Nomura N., Yoda K.
    Genes Cells 11:673-684(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, SUBCELLULAR LOCATION.
  5. Cited for: IDENTIFICATION BY MASS SPECTROMETRY, IDENTIFICATION IN THE CENPA-CAD COMPLEX WITH CENPI; CENPK; CENPO; CENPP; CENPQ; CENPR AND CENPS.
  6. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
    Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
    Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-53, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.

Entry informationi

Entry nameiCENPL_HUMAN
AccessioniPrimary (citable) accession number: Q8N0S6
Secondary accession number(s): Q5TEL5, Q96ND4
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 25, 2006
Last sequence update: July 25, 2006
Last modified: June 8, 2016
This is version 106 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.