Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Synaptonemal complex central element protein 1

Gene

SYCE1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Major component of the transverse central element of synaptonemal complexes (SCS), formed between homologous chromosomes during meiotic prophase. Requires SYCP1 in order to be incorporated into the central element. May have a role in the synaptonemal complex assembly, stabilization and recombination (By similarity).By similarity

GO - Biological processi

  • cell division Source: UniProtKB-KW
  • synaptonemal complex assembly Source: BHF-UCL
Complete GO annotation...

Keywords - Biological processi

Cell cycle, Cell division, Meiosis

Enzyme and pathway databases

ReactomeiR-HSA-1221632. Meiotic synapsis.

Names & Taxonomyi

Protein namesi
Recommended name:
Synaptonemal complex central element protein 1
Alternative name(s):
Cancer/testis antigen 76
Short name:
CT76
Gene namesi
Name:SYCE1
Synonyms:C10orf94
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 10

Organism-specific databases

HGNCiHGNC:28852. SYCE1.

Subcellular locationi

  • Nucleus
  • Chromosome

  • Note: Associates with chromatin. In prophase I stage of meiosis, localizes in the transverse central elements of the central region between lateral elements of the synaptonemal complexes. Found only where the chromosome cores are synapsed. Colocalizes with SYCE2 in the central elements (By similarity).By similarity

GO - Cellular componenti

  • central element Source: HGNC
Complete GO annotation...

Keywords - Cellular componenti

Chromosome, Nucleus

Pathology & Biotechi

Organism-specific databases

Orphaneti619. Primary ovarian failure.
PharmGKBiPA134876767.

Polymorphism and mutation databases

BioMutaiSYCE1.
DMDMi118573896.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 351351Synaptonemal complex central element protein 1PRO_0000261426Add
BLAST

Proteomic databases

EPDiQ8N0S2.
MaxQBiQ8N0S2.
PaxDbiQ8N0S2.
PRIDEiQ8N0S2.

PTM databases

iPTMnetiQ8N0S2.
PhosphoSiteiQ8N0S2.

Expressioni

Gene expression databases

BgeeiQ8N0S2.
CleanExiHS_SYCE1.
ExpressionAtlasiQ8N0S2. baseline and differential.
GenevisibleiQ8N0S2. HS.

Organism-specific databases

HPAiHPA040208.

Interactioni

Subunit structurei

Homodimer. Found in a complex with SYCP1 and SYCE2. Interacts with SYCP1, SYCE2 and SYCE3 (By similarity).By similarity

Binary interactionsi

WithEntry#Exp.IntActNotes
ALOX5P099173EBI-6872807,EBI-79934
BFSP2Q135153EBI-6872807,EBI-10229433
CCDC102BA1A4H13EBI-6872807,EBI-10171570
CCDC53Q9Y3C03EBI-6872807,EBI-712969
CINPQ9BW663EBI-6872807,EBI-739784
CYTH3O437393EBI-6872807,EBI-741648
EDRF1Q3B7T1-53EBI-6872807,EBI-10240074
FAM161AQ3B8203EBI-6872807,EBI-719941
HAUS1Q96CS23EBI-6872807,EBI-2514791
HMG20BQ9P0W23EBI-6872807,EBI-713401
HOOK1Q9UJC33EBI-6872807,EBI-746704
HSPB7Q9UBY93EBI-6872807,EBI-739361
IQUBQ8NA543EBI-6872807,EBI-10220600
KIFC3Q9BVG83EBI-6872807,EBI-2125614
MRFAP1L1Q96HT83EBI-6872807,EBI-748896
NME7Q9Y5B83EBI-6872807,EBI-744782
RBCK1Q9BYM83EBI-6872807,EBI-2340624
SCNM1Q9BWG63EBI-6872807,EBI-748391
SKA1Q96BD83EBI-6872807,EBI-741854
SMARCE1Q969G33EBI-6872807,EBI-455078
SPERTQ8NA613EBI-6872807,EBI-741724
SSX2BQ163853EBI-6872807,EBI-2210673
STX19Q8N4C73EBI-6872807,EBI-8484990
TPM1P094933EBI-6872807,EBI-351158
TPM1P09493-53EBI-6872807,EBI-10196387
TPM3P067533EBI-6872807,EBI-355607
TPM3Q5VU623EBI-6872807,EBI-10184033
TRAF1Q130773EBI-6872807,EBI-359224
TSG101Q998163EBI-6872807,EBI-346882
ZNF124Q159733EBI-6872807,EBI-2555767

Protein-protein interaction databases

BioGridi125023. 30 interactions.
IntActiQ8N0S2. 30 interactions.
STRINGi9606.ENSP00000341282.

Structurei

3D structure databases

ProteinModelPortaliQ8N0S2.
SMRiQ8N0S2. Positions 52-94.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili52 – 290239Sequence analysisAdd
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi259 – 29739Gln-richAdd
BLAST

Sequence similaritiesi

Belongs to the SYCE family.Curated

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiENOG410IJFM. Eukaryota.
ENOG410YHCQ. LUCA.
GeneTreeiENSGT00390000017352.
HOGENOMiHOG000059636.
HOVERGENiHBG094011.
InParanoidiQ8N0S2.
KOiK19534.
OMAiGMQVPAQ.
OrthoDBiEOG7XH6QB.
PhylomeDBiQ8N0S2.
TreeFamiTF337303.

Family and domain databases

InterProiIPR026676. SYCE1.
[Graphical view]
PANTHERiPTHR21731. PTHR21731. 1 hit.
PfamiPF15233. SYCE1. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8N0S2-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAGRSLTSKA EPTAGAVDRA EKAGGQDTSS QKIEDLMEMV QKLQKVGSLE
60 70 80 90 100
PRVEVLINRI NEVQQAKKKA NKDLGEARTI CEALQKELDS LHGEKVHLKE
110 120 130 140 150
ILSKKQETLR ILRLHCQEKE SEAHRKHTML QECKERISAL NLQIEEEKNK
160 170 180 190 200
QRQLRLAFEE QLEDLMGQHK DLWDFHMPER LAKEICALDS SKEQLLKEEK
210 220 230 240 250
LVKATLEDVK HQLCSLCGAE GPSTLDEGLF LRSQEAAATV QLFQEEHRKA
260 270 280 290 300
EELLAAAAQR HQQLQQKCQQ QQQKRQRLKE ELEKHGMQVP AQAQSTQEEE
310 320 330 340 350
AGPGDVASPK PLKGERPGAA HQAGPDVLIG QEDTLHPDLS PRGFQEIKEL

F
Length:351
Mass (Da):39,699
Last modified:November 28, 2006 - v2
Checksum:i12E45FF6696080F8
GO
Isoform 2 (identifier: Q8N0S2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-36: Missing.
     308-351: SPKPLKGERPGAAHQAGPDVLIGQEDTLHPDLSPRGFQEIKELF → PRPGRPVTWWS

Show »
Length:282
Mass (Da):32,601
Checksum:iB0D483BF27BB31C7
GO
Isoform 3 (identifier: Q8N0S2-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-128: Missing.
     308-351: SPKPLKGERPGAAHQAGPDVLIGQEDTLHPDLSPRGFQEIKELF → PRPGRPVTWWS

Note: No experimental confirmation available.
Show »
Length:190
Mass (Da):21,902
Checksum:iC888D4B18C59550B
GO

Sequence cautioni

The sequence AAH34821.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti321 – 3211H → R in AAH34821 (PubMed:15489334).Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti132 – 1321E → D.1 Publication
Corresponds to variant rs8181357 [ dbSNP | Ensembl ].
VAR_029385
Natural varianti183 – 1831K → R.1 Publication
Corresponds to variant rs3747881 [ dbSNP | Ensembl ].
VAR_029386
Natural varianti317 – 3171P → A.
Corresponds to variant rs11101822 [ dbSNP | Ensembl ].
VAR_029387

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 128128Missing in isoform 3. 1 PublicationVSP_021690Add
BLAST
Alternative sequencei1 – 3636Missing in isoform 2. 2 PublicationsVSP_021691Add
BLAST
Alternative sequencei308 – 35144SPKPL…IKELF → PRPGRPVTWWS in isoform 2 and isoform 3. 2 PublicationsVSP_021692Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY027807 mRNA. Translation: AAK14796.1.
AY027808 mRNA. Translation: AAK14797.1.
AY028079 Genomic DNA. Translation: AAK21976.1.
AK314978 mRNA. Translation: BAG37477.1.
AL161645 Genomic DNA. Translation: CAH70048.1.
CH471211 Genomic DNA. Translation: EAW61359.1.
BC034821 mRNA. Translation: AAH34821.1. Different initiation.
CCDSiCCDS44501.1. [Q8N0S2-1]
CCDS7687.1. [Q8N0S2-2]
RefSeqiNP_001137235.1. NM_001143763.1.
NP_001137236.1. NM_001143764.1. [Q8N0S2-1]
NP_570140.1. NM_130784.2. [Q8N0S2-2]
UniGeneiHs.553795.

Genome annotation databases

EnsembliENST00000343131; ENSP00000341282; ENSG00000171772. [Q8N0S2-1]
ENST00000368517; ENSP00000357503; ENSG00000171772. [Q8N0S2-2]
GeneIDi93426.
KEGGihsa:93426.
UCSCiuc001lno.2. human. [Q8N0S2-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY027807 mRNA. Translation: AAK14796.1.
AY027808 mRNA. Translation: AAK14797.1.
AY028079 Genomic DNA. Translation: AAK21976.1.
AK314978 mRNA. Translation: BAG37477.1.
AL161645 Genomic DNA. Translation: CAH70048.1.
CH471211 Genomic DNA. Translation: EAW61359.1.
BC034821 mRNA. Translation: AAH34821.1. Different initiation.
CCDSiCCDS44501.1. [Q8N0S2-1]
CCDS7687.1. [Q8N0S2-2]
RefSeqiNP_001137235.1. NM_001143763.1.
NP_001137236.1. NM_001143764.1. [Q8N0S2-1]
NP_570140.1. NM_130784.2. [Q8N0S2-2]
UniGeneiHs.553795.

3D structure databases

ProteinModelPortaliQ8N0S2.
SMRiQ8N0S2. Positions 52-94.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi125023. 30 interactions.
IntActiQ8N0S2. 30 interactions.
STRINGi9606.ENSP00000341282.

PTM databases

iPTMnetiQ8N0S2.
PhosphoSiteiQ8N0S2.

Polymorphism and mutation databases

BioMutaiSYCE1.
DMDMi118573896.

Proteomic databases

EPDiQ8N0S2.
MaxQBiQ8N0S2.
PaxDbiQ8N0S2.
PRIDEiQ8N0S2.

Protocols and materials databases

DNASUi93426.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000343131; ENSP00000341282; ENSG00000171772. [Q8N0S2-1]
ENST00000368517; ENSP00000357503; ENSG00000171772. [Q8N0S2-2]
GeneIDi93426.
KEGGihsa:93426.
UCSCiuc001lno.2. human. [Q8N0S2-1]

Organism-specific databases

CTDi93426.
GeneCardsiSYCE1.
HGNCiHGNC:28852. SYCE1.
HPAiHPA040208.
MIMi611486. gene.
neXtProtiNX_Q8N0S2.
Orphaneti619. Primary ovarian failure.
PharmGKBiPA134876767.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IJFM. Eukaryota.
ENOG410YHCQ. LUCA.
GeneTreeiENSGT00390000017352.
HOGENOMiHOG000059636.
HOVERGENiHBG094011.
InParanoidiQ8N0S2.
KOiK19534.
OMAiGMQVPAQ.
OrthoDBiEOG7XH6QB.
PhylomeDBiQ8N0S2.
TreeFamiTF337303.

Enzyme and pathway databases

ReactomeiR-HSA-1221632. Meiotic synapsis.

Miscellaneous databases

GenomeRNAii93426.
PROiQ8N0S2.
SOURCEiSearch...

Gene expression databases

BgeeiQ8N0S2.
CleanExiHS_SYCE1.
ExpressionAtlasiQ8N0S2. baseline and differential.
GenevisibleiQ8N0S2. HS.

Family and domain databases

InterProiIPR026676. SYCE1.
[Graphical view]
PANTHERiPTHR21731. PTHR21731. 1 hit.
PfamiPF15233. SYCE1. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Genomic analysis of human chromosome 10q and 4q telomeres suggests a common origin."
    van Geel M., Dickson M.C., Beck A.F., Bolland D.J., Frants R.R., van der Maarel S.M., de Jong P.J., Hewitt J.E.
    Genomics 79:210-217(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2 AND 3).
    Tissue: Fetal brain.
  2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Testis.
  3. "The DNA sequence and comparative analysis of human chromosome 10."
    Deloukas P., Earthrowl M.E., Grafham D.V., Rubenfield M., French L., Steward C.A., Sims S.K., Jones M.C., Searle S., Scott C., Howe K., Hunt S.E., Andrews T.D., Gilbert J.G.R., Swarbreck D., Ashurst J.L., Taylor A., Battles J.
    , Bird C.P., Ainscough R., Almeida J.P., Ashwell R.I.S., Ambrose K.D., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Bates K., Beasley H., Bray-Allen S., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Cahill P., Camire D., Carter N.P., Chapman J.C., Clark S.Y., Clarke G., Clee C.M., Clegg S., Corby N., Coulson A., Dhami P., Dutta I., Dunn M., Faulkner L., Frankish A., Frankland J.A., Garner P., Garnett J., Gribble S., Griffiths C., Grocock R., Gustafson E., Hammond S., Harley J.L., Hart E., Heath P.D., Ho T.P., Hopkins B., Horne J., Howden P.J., Huckle E., Hynds C., Johnson C., Johnson D., Kana A., Kay M., Kimberley A.M., Kershaw J.K., Kokkinaki M., Laird G.K., Lawlor S., Lee H.M., Leongamornlert D.A., Laird G., Lloyd C., Lloyd D.M., Loveland J., Lovell J., McLaren S., McLay K.E., McMurray A., Mashreghi-Mohammadi M., Matthews L., Milne S., Nickerson T., Nguyen M., Overton-Larty E., Palmer S.A., Pearce A.V., Peck A.I., Pelan S., Phillimore B., Porter K., Rice C.M., Rogosin A., Ross M.T., Sarafidou T., Sehra H.K., Shownkeen R., Skuce C.D., Smith M., Standring L., Sycamore N., Tester J., Thorpe A., Torcasso W., Tracey A., Tromans A., Tsolas J., Wall M., Walsh J., Wang H., Weinstock K., West A.P., Willey D.L., Whitehead S.L., Wilming L., Wray P.W., Young L., Chen Y., Lovering R.C., Moschonas N.K., Siebert R., Fechtel K., Bentley D., Durbin R.M., Hubbard T., Doucette-Stamm L., Beck S., Smith D.R., Rogers J.
    Nature 429:375-381(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANTS ASP-132 AND ARG-183.
    Tissue: Brain.

Entry informationi

Entry nameiSYCE1_HUMAN
AccessioniPrimary (citable) accession number: Q8N0S2
Secondary accession number(s): B2RC80, Q9BWU3, Q9BWU4
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 28, 2006
Last sequence update: November 28, 2006
Last modified: June 8, 2016
This is version 106 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 10
    Human chromosome 10: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.