Q8MRC9 (GALT9_DROME) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 80.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Putative polypeptide N-acetylgalactosaminyltransferase 9 Short name=pp-GaNTase 9 EC=2.4.1.41 Alternative name(s): Protein-UDP acetylgalactosaminyltransferase 9 UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 9 | ||||
| Gene names |
| ||||
| Organism | Drosophila melanogaster (Fruit fly) | ||||
| Taxonomic identifier | 7227 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Arthropoda › Hexapoda › Insecta › Pterygota › Neoptera › Endopterygota › Diptera › Brachycera › Muscomorpha › Ephydroidea › Drosophilidae › Drosophila › Sophophora |
Protein attributes
| Sequence length | 650 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Function | May catalyze the initial reaction in O-linked oligosaccharide biosynthesis, the transfer of an N-acetyl-D-galactosamine residue to a serine or threonine residue on the protein receptor By similarity. |
| Catalytic activity | UDP-N-acetyl-D-galactosamine + polypeptide = UDP + N-acetyl-D-galactosaminyl-polypeptide. |
| Cofactor | Manganese By similarity. Calcium By similarity. |
| Pathway | |
| Subcellular location | Golgi apparatus membrane; Single-pass type II membrane protein By similarity. |
| Domain | There are two conserved domains in the glycosyltransferase region: the N-terminal domain (domain A, also called GT1 motif), which is probably involved in manganese coordination and substrate binding and the C-terminal domain (domain B, also called Gal/GalNAc-T motif), which is probably involved in catalytic reaction and UDP-Gal binding By similarity. The ricin B-type lectin domain binds to GalNAc and contributes to the glycopeptide specificity By similarity. |
| Sequence similarities | Belongs to the glycosyltransferase 2 family. GalNAc-T subfamily. Contains 1 ricin B-type lectin domain. |
| Sequence caution | The sequence ABL75647.1 differs from that shown. Reason: Intron retention. The sequence ABL75689.1 differs from that shown. Reason: Intron retention. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Golgi apparatus Membrane |
| Coding sequence diversity | Alternative splicing |
| Domain | Signal-anchor Transmembrane Transmembrane helix |
| Ligand | Calcium Lectin Manganese |
| Molecular function | Glycosyltransferase Transferase |
| PTM | Disulfide bond Glycoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Cellular component | Golgi membrane Inferred from electronic annotation. Source: UniProtKB-SubCell integral to membraneInferred from electronic annotation. Source: UniProtKB-KW |
| Molecular function | polypeptide N-acetylgalactosaminyltransferase activity Inferred from electronic annotation. Source: EC sugar bindingInferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform A (identifier: Q8MRC9-1) Also known as: D; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform B (identifier: Q8MRC9-2) Also known as: C; The sequence of this isoform differs from the canonical sequence as follows: 526-556: RNLGYGGRTCLDAPAGKKHQKKAVGTYPCHR → ANVPNGMCLDAKEKSEEETPVSIYECHG | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform E (identifier: Q8MRC9-3) The sequence of this isoform differs from the canonical sequence as follows: 1-383: Missing. 526-556: RNLGYGGRTCLDAPAGKKHQKKAVGTYPCHR → ANVPNGMCLDAKEKSEEETPVSIYECHG | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform F (identifier: Q8MRC9-4) The sequence of this isoform differs from the canonical sequence as follows: 2-22: AFIWRRRSTTIVKLVAFALAI → NFYLSSWHCQVTQSGLVAGLE 23-273: Missing. 526-556: RNLGYGGRTCLDAPAGKKHQKKAVGTYPCHR → ANVPNGMCLDAKEKSEEETPVSIYECHG | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 650 | 650 | Putative polypeptide N-acetylgalactosaminyltransferase 9 | PRO_0000059163 | |||||||
Regions | |||||||||||
| Topological domain | 1 – 11 | 11 | Cytoplasmic Potential | ||||||||
| Transmembrane | 12 – 31 | 20 | Helical; Signal-anchor for type II membrane protein; Potential | ||||||||
| Topological domain | 32 – 650 | 619 | Lumenal Potential | ||||||||
| Domain | 521 – 643 | 123 | Ricin B-type lectin | ||||||||
| Region | 208 – 317 | 110 | Catalytic subdomain A | ||||||||
| Region | 378 – 440 | 63 | Catalytic subdomain B | ||||||||
| Compositional bias | 43 – 90 | 48 | Gly-rich | ||||||||
Amino acid modifications | |||||||||||
| Glycosylation | 321 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 373 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Disulfide bond | 535 ↔ 554 | By similarity | |||||||||
| Disulfide bond | 577 ↔ 590 | By similarity | |||||||||
| Disulfide bond | 616 ↔ 631 | By similarity | |||||||||
Natural variations | |||||||||||
| Alternative sequence | 1 – 383 | 383 | Missing in isoform E. | VSP_034632 | |||||||
| Alternative sequence | 2 – 22 | 21 | AFIWR…FALAI → NFYLSSWHCQVTQSGLVAGL E in isoform F. | VSP_034633 | |||||||
| Alternative sequence | 23 – 273 | 251 | Missing in isoform F. | VSP_034634 | |||||||
| Alternative sequence | 526 – 556 | 31 | RNLGY…YPCHR → ANVPNGMCLDAKEKSEEETP VSIYECHG in isoform B, isoform E and isoform F. | VSP_034635 | |||||||
Experimental info | |||||||||||
| Sequence conflict | 145 | 1 | N → D in AAM51988. Ref.3 | ||||||||
| Sequence conflict | 454 | 1 | L → P in AAM51988. Ref.3 | ||||||||
| Sequence conflict | 472 | 1 | Y → C in AAM51988. Ref.3 | ||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AE013599 Genomic DNA. Translation: AAF57964.3. AE013599 Genomic DNA. Translation: AAF57966.2. AE013599 Genomic DNA. Translation: ABV53822.1. AE013599 Genomic DNA. Translation: ABV53823.1. AE013599 Genomic DNA. Translation: ABV53824.1. AY121661 mRNA. Translation: AAM51988.1. BT029588 mRNA. Translation: ABL75647.1. Sequence problems. BT029630 mRNA. Translation: ABL75689.1. Sequence problems. |
| RefSeq | NP_001097341.1. NM_001103871.1. NP_001097342.1. NM_001103872.1. NP_001097343.1. NM_001103873.1. NP_725602.1. NM_166188.1. NP_725603.2. NM_166189.2. |
| UniGene | Dm.24533. |
3D structure databases | |
| ProteinModelPortal | Q8MRC9. |
| SMR | Q8MRC9. Positions 138-650. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q8MRC9. 1 interaction. |
| MINT | MINT-964044. |
Protein family/group databases | |
| CAZy | CBM13. Carbohydrate-Binding Module Family 13. GT27. Glycosyltransferase Family 27. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| EnsemblMetazoa | FBtr0087112; FBpp0086258; FBgn0050463. FBtr0113380; FBpp0112292; FBgn0050463. |
| GeneID | 246627. |
| KEGG | dme:Dmel_CG30463. |
| UCSC | CG30463-RA. d. melanogaster. |
Organism-specific databases | |
| FlyBase | FBgn0050463. CG30463. |
Phylogenomic databases | |
| eggNOG | inNOG08001. |
| GeneTree | EMGT00050000004060. |
| InParanoid | Q8MRC9. |
| OMA | RSTTIVK. |
| OrthoDB | EOG46WWQF. |
| PhylomeDB | Q8MRC9. |
Gene expression databases | |
| Bgee | Q8MRC9. |
| GermOnline | CG30463. Drosophila melanogaster. |
Family and domain databases | |
| InterPro | IPR001173. Glyco_trans_2. IPR008997. Ricin_B-rel_lectin. IPR000772. Ricin_B_lectin. [Graphical view] |
| KO | K00710. |
| Pfam | PF00535. Glycos_transf_2. 1 hit. PF00652. Ricin_B_lectin. 1 hit. [Graphical view] |
| SMART | SM00458. RICIN. 1 hit. [Graphical view] |
| SUPFAM | SSF50370. RicinB_like. 1 hit. |
| PROSITE | PS50231. RICIN_B_LECTIN. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 843268. |
Entry information
| Entry name | GALT9_DROME | ||||||||
| Accession | Primary (citable) accession number: Q8MRC9 Secondary accession number(s): A1A6R7 Q9V7T0 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Drosophila annotation project | ||||||||
Relevant documents
| Drosophila Drosophila: entries, gene names and cross-references to FlyBase |
| PATHWAY comments Index of metabolic and biosynthesis pathways |
| SIMILARITY comments Index of protein domains and families |

Clusters with