Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Cytoplasmic phosphatidylinositol transfer protein 1

Gene

Pitpnc1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

Phosphatidylinositol transfer proteins mediate the monomeric transport of lipids by shielding a lipid from the aqueous environment and binding the lipid in a hydrophobic cavity. Able to transfer phosphatidylinositol in vitro. Isoform 2 specifically binds to phosphatidylinositol but not to other phospholipids and may play a role in the phosphoinositide-mediated signaling in the neural development.1 Publication

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

Lipid transport, Transport

Keywords - Ligandi

Lipid-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Cytoplasmic phosphatidylinositol transfer protein 1
Alternative name(s):
Mammalian rdgB homolog beta
Short name:
M-rdgB beta
Short name:
MrdgBbeta
Short name:
mM-rdgBbeta
Retinal degeneration B homolog beta
Short name:
RdgBbeta
Gene namesi
Name:Pitpnc1
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 11

Organism-specific databases

MGIiMGI:1919045. Pitpnc1.

Subcellular locationi

Isoform 1 :
  • Cytoplasm 1 Publication
Isoform 2 :
  • Cytoplasm 1 Publication
  • Nucleus 1 Publication

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 332332Cytoplasmic phosphatidylinositol transfer protein 1PRO_0000287531Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei119 – 1191PhosphoserineCombined sources
Modified residuei122 – 1221PhosphoserineCombined sources
Modified residuei270 – 2701PhosphoserineCombined sources
Modified residuei274 – 2741PhosphoserineCombined sources
Modified residuei278 – 2781PhosphothreonineCombined sources

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ8K4R4.
MaxQBiQ8K4R4.
PaxDbiQ8K4R4.
PeptideAtlasiQ8K4R4.
PRIDEiQ8K4R4.

PTM databases

iPTMnetiQ8K4R4.

Expressioni

Tissue specificityi

Isoform 1 is widely expressed. Isoform 2 is weakly expressed. In brain, isoform 2 is weakly expressed and is rather confined to the embryonic stage. In contrast, isoform 1 is widely expressed in brain, with expression in the gray matters of pre- and postnatal brains.1 Publication

Gene expression databases

BgeeiQ8K4R4.
ExpressionAtlasiQ8K4R4. baseline and differential.
GenevisibleiQ8K4R4. MM.

Interactioni

Protein-protein interaction databases

IntActiQ8K4R4. 1 interaction.
MINTiMINT-4117884.
STRINGi10090.ENSMUSP00000099353.

Structurei

3D structure databases

ProteinModelPortaliQ8K4R4.
SMRiQ8K4R4. Positions 1-242.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Phylogenomic databases

eggNOGiKOG3668. Eukaryota.
COG5083. LUCA.
GeneTreeiENSGT00760000119216.
HOGENOMiHOG000006717.
HOVERGENiHBG058915.
InParanoidiQ8K4R4.
OMAiGSTENCL.
OrthoDBiEOG7NW69J.
TreeFamiTF313279.

Family and domain databases

Gene3Di3.30.530.20. 1 hit.
InterProiIPR001666. PI_transfer.
IPR023393. START-like_dom.
[Graphical view]
PANTHERiPTHR10658. PTHR10658. 1 hit.
PfamiPF02121. IP_trans. 1 hit.
[Graphical view]
PRINTSiPR00391. PITRANSFER.

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8K4R4-1) [UniParc]FASTAAdd to basket

Also known as: mM-rdgBbeta

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MLLKEYRICM PLTVDEYKIG QLYMISKHSH EQSDRGEGVE VVQNEPFEDP
60 70 80 90 100
HHGNGQFTEK RVYLNSKLPS WARAVVPKIF YVTEKAWNYY PYTITEYTCS
110 120 130 140 150
FLPKFSIHIE TKYEDNKGSN DSIFDSEAKD LEREVCFIDI ACDEIPERYY
160 170 180 190 200
KESEDPKHFK SEKTGRGQLR EGWRDNHQPI MCSYKLVTVK FEVWGLQTRV
210 220 230 240 250
EQFVHKVVRD ILLIGHRQAF AWVDEWYDMT MDEVREFERA TQEATNKKIG
260 270 280 290 300
VFPPAISISS IALLPSSVRS APSSAPSTPL STDAPEFLSI PKDRPRKKSA
310 320 330
PETLTLPDPE KKATLNLPGV YTSEKPCRPK SE
Note: No experimental confirmation available.
Length:332
Mass (Da):38,384
Last modified:October 1, 2002 - v1
Checksum:iA20BF9EEAB80E178
GO
Isoform 2 (identifier: Q8K4R4-2) [UniParc]FASTAAdd to basket

Also known as: mM-rdgBbeta1

The sequence of this isoform differs from the canonical sequence as follows:
     233-268: EVREFERATQEATNKKIGVFPPAISISSIALLPSSV → DVREYEKNMHEQTNIKVCNQHSSTVDDIESHAQTST
     269-332: Missing.

Show »
Length:268
Mass (Da):31,773
Checksum:iDFEC06FD981B78C1
GO
Isoform 3 (identifier: Q8K4R4-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     228-234: DMTMDEV → GKSDGPK
     235-332: Missing.

Note: No experimental confirmation available.
Show »
Length:234
Mass (Da):27,691
Checksum:iB28C7BBDF8EAB0C3
GO
Isoform 4 (identifier: Q8K4R4-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     208-209: VR → GC
     210-332: Missing.

Note: No experimental confirmation available.
Show »
Length:209
Mass (Da):24,712
Checksum:i260A1747F0A7E2DE
GO

Sequence cautioni

The sequence CAM17314.1 differs from that shown. Reason: Erroneous gene model prediction. Curated
The sequence CAM17315.1 differs from that shown. Reason: Erroneous gene model prediction. Curated
The sequence CAM20627.1 differs from that shown. Reason: Erroneous gene model prediction. Curated
The sequence CAM25441.1 differs from that shown. Reason: Erroneous gene model prediction. Curated
The sequence CAM25442.1 differs from that shown. Reason: Erroneous gene model prediction. Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei208 – 2092VR → GC in isoform 4. 1 PublicationVSP_025546
Alternative sequencei210 – 332123Missing in isoform 4. 1 PublicationVSP_025547Add
BLAST
Alternative sequencei228 – 2347DMTMDEV → GKSDGPK in isoform 3. 1 PublicationVSP_025548
Alternative sequencei233 – 26836EVREF…LPSSV → DVREYEKNMHEQTNIKVCNQ HSSTVDDIESHAQTST in isoform 2. 2 PublicationsVSP_025549Add
BLAST
Alternative sequencei235 – 33298Missing in isoform 3. 1 PublicationVSP_025550Add
BLAST
Alternative sequencei269 – 33264Missing in isoform 2. 2 PublicationsVSP_025551Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB077281 mRNA. Translation: BAC02913.1.
AB077282 mRNA. Translation: BAC02914.1.
AK153625 mRNA. Translation: BAE32124.1.
AK171340 mRNA. Translation: BAE42401.1.
AL596116, AL645687, AL645905 Genomic DNA. Translation: CAM20633.1.
AL596116, AL645687, AL645905 Genomic DNA. Translation: CAM20627.1. Sequence problems.
AL596116, AL645687, AL645905 Genomic DNA. Translation: CAM20628.1.
AL645687, AL596116, AL645905 Genomic DNA. Translation: CAM25441.1. Sequence problems.
AL645687, AL596116, AL645905 Genomic DNA. Translation: CAM25442.1. Sequence problems.
AL645687, AL596116, AL645905 Genomic DNA. Translation: CAM25443.1.
AL645905, AL596116, AL645687 Genomic DNA. Translation: CAM17314.1. Sequence problems.
AL645905, AL596116, AL645687 Genomic DNA. Translation: CAM17315.1. Sequence problems.
AL645905, AL596116, AL645687 Genomic DNA. Translation: CAM17317.1.
BC108351 mRNA. Translation: AAI08352.1.
CCDSiCCDS25567.1. [Q8K4R4-2]
RefSeqiNP_665822.1. NM_145823.2. [Q8K4R4-2]
XP_006534325.1. XM_006534262.2.
UniGeneiMm.397413.
Mm.476186.

Genome annotation databases

EnsembliENSMUST00000103064; ENSMUSP00000099353; ENSMUSG00000040430. [Q8K4R4-2]
GeneIDi71795.
KEGGimmu:71795.
UCSCiuc007mak.1. mouse. [Q8K4R4-1]
uc007mal.1. mouse. [Q8K4R4-2]
uc007man.1. mouse. [Q8K4R4-3]
uc007mao.1. mouse. [Q8K4R4-4]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB077281 mRNA. Translation: BAC02913.1.
AB077282 mRNA. Translation: BAC02914.1.
AK153625 mRNA. Translation: BAE32124.1.
AK171340 mRNA. Translation: BAE42401.1.
AL596116, AL645687, AL645905 Genomic DNA. Translation: CAM20633.1.
AL596116, AL645687, AL645905 Genomic DNA. Translation: CAM20627.1. Sequence problems.
AL596116, AL645687, AL645905 Genomic DNA. Translation: CAM20628.1.
AL645687, AL596116, AL645905 Genomic DNA. Translation: CAM25441.1. Sequence problems.
AL645687, AL596116, AL645905 Genomic DNA. Translation: CAM25442.1. Sequence problems.
AL645687, AL596116, AL645905 Genomic DNA. Translation: CAM25443.1.
AL645905, AL596116, AL645687 Genomic DNA. Translation: CAM17314.1. Sequence problems.
AL645905, AL596116, AL645687 Genomic DNA. Translation: CAM17315.1. Sequence problems.
AL645905, AL596116, AL645687 Genomic DNA. Translation: CAM17317.1.
BC108351 mRNA. Translation: AAI08352.1.
CCDSiCCDS25567.1. [Q8K4R4-2]
RefSeqiNP_665822.1. NM_145823.2. [Q8K4R4-2]
XP_006534325.1. XM_006534262.2.
UniGeneiMm.397413.
Mm.476186.

3D structure databases

ProteinModelPortaliQ8K4R4.
SMRiQ8K4R4. Positions 1-242.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

IntActiQ8K4R4. 1 interaction.
MINTiMINT-4117884.
STRINGi10090.ENSMUSP00000099353.

PTM databases

iPTMnetiQ8K4R4.

Proteomic databases

EPDiQ8K4R4.
MaxQBiQ8K4R4.
PaxDbiQ8K4R4.
PeptideAtlasiQ8K4R4.
PRIDEiQ8K4R4.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000103064; ENSMUSP00000099353; ENSMUSG00000040430. [Q8K4R4-2]
GeneIDi71795.
KEGGimmu:71795.
UCSCiuc007mak.1. mouse. [Q8K4R4-1]
uc007mal.1. mouse. [Q8K4R4-2]
uc007man.1. mouse. [Q8K4R4-3]
uc007mao.1. mouse. [Q8K4R4-4]

Organism-specific databases

CTDi26207.
MGIiMGI:1919045. Pitpnc1.

Phylogenomic databases

eggNOGiKOG3668. Eukaryota.
COG5083. LUCA.
GeneTreeiENSGT00760000119216.
HOGENOMiHOG000006717.
HOVERGENiHBG058915.
InParanoidiQ8K4R4.
OMAiGSTENCL.
OrthoDBiEOG7NW69J.
TreeFamiTF313279.

Miscellaneous databases

ChiTaRSiPitpnc1. mouse.
PROiQ8K4R4.
SOURCEiSearch...

Gene expression databases

BgeeiQ8K4R4.
ExpressionAtlasiQ8K4R4. baseline and differential.
GenevisibleiQ8K4R4. MM.

Family and domain databases

Gene3Di3.30.530.20. 1 hit.
InterProiIPR001666. PI_transfer.
IPR023393. START-like_dom.
[Graphical view]
PANTHERiPTHR10658. PTHR10658. 1 hit.
PfamiPF02121. IP_trans. 1 hit.
[Graphical view]
PRINTSiPR00391. PITRANSFER.
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Cloning and characterization of a novel variant (mM-rdgBbeta1) of mouse M-rdgBs, mammalian homologs of Drosophila retinal degeneration B gene proteins, and its mRNA localization in mouse brain in comparison with other M-rdgBs."
    Takano N., Owada Y., Suzuki R., Sakagami H., Shimosegawa T., Kondo H.
    J. Neurochem. 84:829-839(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), FUNCTION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
    Strain: C57BL/6J.
    Tissue: Brain.
  2. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3 AND 4).
    Strain: C57BL/6J.
    Tissue: Thymus.
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    Strain: C57BL/6J.
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Olfactory epithelium.
  5. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Embryonic brain.
  6. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-119; SER-122; SER-270; SER-274 AND THR-278, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Brain, Heart, Lung and Spleen.

Entry informationi

Entry nameiPITC1_MOUSE
AccessioniPrimary (citable) accession number: Q8K4R4
Secondary accession number(s): A2A650
, A2A651, Q3TBB3, Q3U5F5, Q8K4R5
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 15, 2007
Last sequence update: October 1, 2002
Last modified: July 6, 2016
This is version 93 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.