Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q8K3W0

- BRE_MOUSE

UniProt

Q8K3W0 - BRE_MOUSE

Protein

BRCA1-A complex subunit BRE

Gene

Bre

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 88 (01 Oct 2014)
      Sequence version 2 (05 May 2009)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Component of the BRCA1-A complex, a complex that specifically recognizes 'Lys-63'-linked ubiquitinated histones H2A and H2AX at DNA lesions sites, leading to target the BRCA1-BARD1 heterodimer to sites of DNA damage at double-strand breaks (DSBs). The BRCA1-A complex also possesses deubiquitinase activity that specifically removes 'Lys-63'-linked ubiquitin on histones H2A and H2AX. In the BRCA1-A complex, it acts as an adapter that bridges the interaction between BABAM1/NBA1 and the rest of the complex, thereby being required for the complex integrity and modulating the E3 ubiquitin ligase activity of the BRCA1-BARD1 heterodimer. Probably also plays a role as a component of the BRISC complex, a multiprotein complex that specifically cleaves 'Lys-63'-linked ubiquitin By similarity. May regulate TNF-alpha signaling through its interactions with TNFRSF1A.By similarity1 Publication

    GO - Molecular functioni

    1. polyubiquitin binding Source: UniProtKB
    2. tumor necrosis factor receptor binding Source: UniProtKB

    GO - Biological processi

    1. apoptotic process Source: UniProtKB-KW
    2. cellular response to DNA damage stimulus Source: UniProtKB
    3. chromatin modification Source: UniProtKB-KW
    4. double-strand break repair Source: UniProtKB
    5. G2 DNA damage checkpoint Source: UniProtKB
    6. positive regulation of DNA repair Source: UniProtKB
    7. response to ionizing radiation Source: UniProtKB

    Keywords - Molecular functioni

    Chromatin regulator

    Keywords - Biological processi

    Apoptosis, DNA damage, DNA repair

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    BRCA1-A complex subunit BRE
    Alternative name(s):
    BRCA1/BRCA2-containing complex subunit 45
    Brain and reproductive organ-expressed protein
    Gene namesi
    Name:BreImported
    OrganismiMus musculus (Mouse)
    Taxonomic identifieri10090 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
    ProteomesiUP000000589: Chromosome 5

    Organism-specific databases

    MGIiMGI:1333875. Bre.

    Subcellular locationi

    Cytoplasm By similarity. Nucleus By similarity
    Note: Localizes at sites of DNA damage at double-strand breaks (DSBs).By similarity

    GO - Cellular componenti

    1. BRCA1-A complex Source: UniProtKB
    2. BRISC complex Source: UniProtKB
    3. cytoplasm Source: UniProtKB
    4. nuclear ubiquitin ligase complex Source: UniProtKB
    5. nucleus Source: UniProtKB

    Keywords - Cellular componenti

    Cytoplasm, Nucleus

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 383383BRCA1-A complex subunit BREPRO_0000224190Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei1 – 11N-acetylmethionineBy similarity
    Modified residuei2 – 21PhosphoserineBy similarity

    Keywords - PTMi

    Acetylation, Phosphoprotein

    Proteomic databases

    MaxQBiQ8K3W0.
    PaxDbiQ8K3W0.
    PRIDEiQ8K3W0.

    Expressioni

    Tissue specificityi

    Expressed in brain, heart, kidney, liver, lung, testis, germinal center B-cells and various mouse cell lines.2 Publications

    Gene expression databases

    BgeeiQ8K3W0.
    CleanExiMM_BRE.
    GenevestigatoriQ8K3W0.

    Interactioni

    Subunit structurei

    Component of the BRCA1-A complex, at least composed of the BRCA1, BARD1, UIMC1/RAP80, FAM175A/Abraxas, BRCC3/BRCC36, BRE/BRCC45 and BABAM1/NBA1. In the BRCA1-A complex, interacts directly with FAM175A/Abraxas, BRCC3/BRCC36 and BABAM1/NBA1. Binds polyubiquitin. Component of the BRISC complex, at least composed of the FAM175B/ABRO1, BRCC3/BRCC36, BRE/BRCC45 and BABAM1/NBA1. Component of the BRCA1/BRCA2 containing complex (BRCC), which also contains BRCA1, BRCA2, BARD1, BRCC3/BRCC36 and RAD51. BRCC is a ubiquitin E3 ligase complex that enhances cellular survival following DNA damage. May interact with FAS By similarity. Interacts with TNFRSF1A.By similarity1 Publication

    Protein-protein interaction databases

    BioGridi223733. 3 interactions.

    Structurei

    3D structure databases

    ProteinModelPortaliQ8K3W0.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Region

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Regioni30 – 147118UEV-like 1Add
    BLAST
    Regioni275 – 36490UEV-like 2Add
    BLAST

    Domaini

    Sequence similaritiesi

    Belongs to the BRE family.Sequence Analysis

    Keywords - Domaini

    Repeat

    Phylogenomic databases

    eggNOGiNOG71563.
    GeneTreeiENSGT00390000004208.
    HOVERGENiHBG071492.
    InParanoidiQ8CJ13.
    KOiK12173.
    OMAiHIPAFPS.
    OrthoDBiEOG7TJ3J9.
    PhylomeDBiQ8K3W0.
    TreeFamiTF328507.

    Family and domain databases

    InterProiIPR010358. Brain/reproduct-express_prot.
    [Graphical view]
    PfamiPF06113. BRE. 1 hit.
    [Graphical view]

    Sequences (5)i

    Sequence statusi: Complete.

    This entry describes 5 isoformsi produced by alternative splicing. Align

    Note: Additional isoforms may exist.Curated

    Isoform 21 Publication (identifier: Q8K3W0-2) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MSPEIALNRI SPMLSPFISS VVRNGKVGLD ATNCLRITDL KSGCTSLTPG    50
    PNCDRFKLHI PYAGETLKWD IIFNAQYPEL PPDFIFGEDA EFLPDPSALH 100
    NLASWNPSNP ECLLLVVKEL VQQYHQFQCG RLRESSRLMF EYQTLLEEPQ 150
    YGENMEIYAG KKNNWTGEFS ARFLLKLPVD FSNIPTYLLK DVNEDPGEDV 200
    ALLSVSFEDT EATQVYPKLY LSPRIEHALG GSSALHIPAF PGGGCLIDYV 250
    PQVCHLLTNK VQYVIQGYHK RREYIAAFLS HFGTGVVEYD AEGFTKLTLL 300
    LMWKDFCFLV HIDLPLFFPR DQPTLTFQSV YHFTNSGQLY SQAQKNYPYS 350
    PRWDGNEMAK RAKAYFKTFV PQFQEAAFAN GKL 383
    Length:383
    Mass (Da):43,545
    Last modified:May 5, 2009 - v2
    Checksum:i7BABA837A8AF82E6
    GO
    Isoform 11 Publication (identifier: Q8K3W0-1) [UniParc]FASTAAdd to Basket

    Also known as: I1 Publication

    The sequence of this isoform differs from the canonical sequence as follows:
         27-43: VGLDATNCLRITDLKSG → IHEKGPSQKLSFKSCSYHLPMCACNEWYGVPDLEKASYLWRKKENHLPLEKGQN

    Show »
    Length:420
    Mass (Da):48,089
    Checksum:i1A9D634D162CE2A8
    GO
    Isoform 3 (identifier: Q8K3W0-4) [UniParc]FASTAAdd to Basket

    Also known as: II, II3+

    The sequence of this isoform differs from the canonical sequence as follows:
         1-138: Missing.

    Show »
    Length:245
    Mass (Da):28,090
    Checksum:i2F77E99B644BD4B4
    GO
    Isoform 4 (identifier: Q8K3W0-5) [UniParc]FASTAAdd to Basket

    Also known as: IV

    The sequence of this isoform differs from the canonical sequence as follows:
         1-43: MSPEIALNRI...CLRITDLKSG → MCACNEWYGVPDLEKASYLWRKKENHLPLEKGQN

    Show »
    Length:374
    Mass (Da):42,994
    Checksum:i6A60137DAF657C78
    GO
    Isoform 5 (identifier: Q8K3W0-6) [UniParc]FASTAAdd to Basket

    Also known as: III

    The sequence of this isoform differs from the canonical sequence as follows:
         1-69: MSPEIALNRISPMLSPFISSVVRNGKVGLDATNCLRITDLKSGCTSLTPGPNCDRFKLHIPYAGETLKW → MCACR

    Show »
    Length:319
    Mass (Da):36,595
    Checksum:i2AE2865E15A82E37
    GO

    Sequence cautioni

    The sequence BAC34385.1 differs from that shown. Reason: Probable cloning artifact.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti105 – 1051W → R in AAH61000. (PubMed:15489334)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 138138Missing in isoform 3. 1 PublicationVSP_051952Add
    BLAST
    Alternative sequencei1 – 6969MSPEI…ETLKW → MCACR in isoform 5. 1 PublicationVSP_037262Add
    BLAST
    Alternative sequencei1 – 4343MSPEI…DLKSG → MCACNEWYGVPDLEKASYLW RKKENHLPLEKGQN in isoform 4. 1 PublicationVSP_037263Add
    BLAST
    Alternative sequencei27 – 4317VGLDA…DLKSG → IHEKGPSQKLSFKSCSYHLP MCACNEWYGVPDLEKASYLW RKKENHLPLEKGQN in isoform 1. 1 PublicationVSP_051953Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF440752 mRNA. Translation: AAL40809.1.
    AF527952 mRNA. Translation: AAM92774.1.
    AF527953 mRNA. Translation: AAM92775.1.
    AF527954 mRNA. Translation: AAM92776.1.
    AF527955 mRNA. Translation: AAM92777.1.
    AF538925 mRNA. Translation: AAN15148.1.
    AK050695 mRNA. Translation: BAC34385.1. Sequence problems.
    AK080991 mRNA. Translation: BAC38108.1.
    AK156929 mRNA. Translation: BAE33900.1.
    BC061000 mRNA. Translation: AAH61000.1.
    BC100565 mRNA. Translation: AAI00566.1.
    CCDSiCCDS19188.1. [Q8K3W0-2]
    CCDS19189.1. [Q8K3W0-1]
    CCDS39058.1. [Q8K3W0-5]
    CCDS39059.1. [Q8K3W0-4]
    CCDS51461.1. [Q8K3W0-6]
    RefSeqiNP_653124.1. NM_144541.1. [Q8K3W0-2]
    NP_851796.1. NM_181279.1. [Q8K3W0-1]
    NP_851797.1. NM_181280.1. [Q8K3W0-5]
    NP_851798.1. NM_181281.1. [Q8K3W0-6]
    NP_851799.1. NM_181282.1. [Q8K3W0-4]
    UniGeneiMm.482126.

    Genome annotation databases

    EnsembliENSMUST00000063813; ENSMUSP00000069133; ENSMUSG00000052139. [Q8K3W0-1]
    ENSMUST00000071531; ENSMUSP00000071462; ENSMUSG00000052139. [Q8K3W0-5]
    ENSMUST00000080598; ENSMUSP00000079434; ENSMUSG00000052139. [Q8K3W0-2]
    ENSMUST00000114507; ENSMUSP00000110152; ENSMUSG00000052139. [Q8K3W0-6]
    ENSMUST00000131995; ENSMUSP00000128351; ENSMUSG00000052139. [Q8K3W0-4]
    GeneIDi107976.
    KEGGimmu:107976.
    UCSCiuc008wza.1. mouse. [Q8K3W0-2]
    uc008wzb.1. mouse. [Q8K3W0-1]
    uc008wzc.1. mouse. [Q8K3W0-5]
    uc008wze.1. mouse. [Q8K3W0-6]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF440752 mRNA. Translation: AAL40809.1 .
    AF527952 mRNA. Translation: AAM92774.1 .
    AF527953 mRNA. Translation: AAM92775.1 .
    AF527954 mRNA. Translation: AAM92776.1 .
    AF527955 mRNA. Translation: AAM92777.1 .
    AF538925 mRNA. Translation: AAN15148.1 .
    AK050695 mRNA. Translation: BAC34385.1 . Sequence problems.
    AK080991 mRNA. Translation: BAC38108.1 .
    AK156929 mRNA. Translation: BAE33900.1 .
    BC061000 mRNA. Translation: AAH61000.1 .
    BC100565 mRNA. Translation: AAI00566.1 .
    CCDSi CCDS19188.1. [Q8K3W0-2 ]
    CCDS19189.1. [Q8K3W0-1 ]
    CCDS39058.1. [Q8K3W0-5 ]
    CCDS39059.1. [Q8K3W0-4 ]
    CCDS51461.1. [Q8K3W0-6 ]
    RefSeqi NP_653124.1. NM_144541.1. [Q8K3W0-2 ]
    NP_851796.1. NM_181279.1. [Q8K3W0-1 ]
    NP_851797.1. NM_181280.1. [Q8K3W0-5 ]
    NP_851798.1. NM_181281.1. [Q8K3W0-6 ]
    NP_851799.1. NM_181282.1. [Q8K3W0-4 ]
    UniGenei Mm.482126.

    3D structure databases

    ProteinModelPortali Q8K3W0.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 223733. 3 interactions.

    Proteomic databases

    MaxQBi Q8K3W0.
    PaxDbi Q8K3W0.
    PRIDEi Q8K3W0.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENSMUST00000063813 ; ENSMUSP00000069133 ; ENSMUSG00000052139 . [Q8K3W0-1 ]
    ENSMUST00000071531 ; ENSMUSP00000071462 ; ENSMUSG00000052139 . [Q8K3W0-5 ]
    ENSMUST00000080598 ; ENSMUSP00000079434 ; ENSMUSG00000052139 . [Q8K3W0-2 ]
    ENSMUST00000114507 ; ENSMUSP00000110152 ; ENSMUSG00000052139 . [Q8K3W0-6 ]
    ENSMUST00000131995 ; ENSMUSP00000128351 ; ENSMUSG00000052139 . [Q8K3W0-4 ]
    GeneIDi 107976.
    KEGGi mmu:107976.
    UCSCi uc008wza.1. mouse. [Q8K3W0-2 ]
    uc008wzb.1. mouse. [Q8K3W0-1 ]
    uc008wzc.1. mouse. [Q8K3W0-5 ]
    uc008wze.1. mouse. [Q8K3W0-6 ]

    Organism-specific databases

    CTDi 9577.
    MGIi MGI:1333875. Bre.

    Phylogenomic databases

    eggNOGi NOG71563.
    GeneTreei ENSGT00390000004208.
    HOVERGENi HBG071492.
    InParanoidi Q8CJ13.
    KOi K12173.
    OMAi HIPAFPS.
    OrthoDBi EOG7TJ3J9.
    PhylomeDBi Q8K3W0.
    TreeFami TF328507.

    Miscellaneous databases

    ChiTaRSi BRE. mouse.
    NextBioi 359811.
    PROi Q8K3W0.
    SOURCEi Search...

    Gene expression databases

    Bgeei Q8K3W0.
    CleanExi MM_BRE.
    Genevestigatori Q8K3W0.

    Family and domain databases

    InterProi IPR010358. Brain/reproduct-express_prot.
    [Graphical view ]
    Pfami PF06113. BRE. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Expression of a conserved mouse stress-modulating gene, Bre: comparison with the human ortholog."
      Ching A.K.K., Li Q., Lim P.L., Chan J.Y.-H., Chui Y.L.
      DNA Cell Biol. 22:497-504(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 3; 4 AND 5), TISSUE SPECIFICITY.
      Strain: BALB/cImported and C57BL/6 X CBA/N.
      Tissue: HeartImported.
    2. "The transcriptional landscape of the mammalian genome."
      Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
      , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
      Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
      Strain: C57BL/6JImported and NODImported.
      Tissue: EmbryoImported, Medulla oblongataImported and SpleenImported.
    3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
      Strain: Czech II.
      Tissue: KidneyImported and Lung.
    4. "BRE: a modulator of TNF-alpha action."
      Gu C., Castellino A., Chan J.Y.-H., Chao M.V.
      FASEB J. 12:1101-1108(1998) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, INTERACTION WITH TNFRSF1A.
    5. Cited for: TISSUE SPECIFICITY.

    Entry informationi

    Entry nameiBRE_MOUSE
    AccessioniPrimary (citable) accession number: Q8K3W0
    Secondary accession number(s): Q497G6
    , Q6P8Z2, Q8BKU1, Q8CJ13, Q8JZP0, Q8K3V9, Q8VHN1
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: February 21, 2006
    Last sequence update: May 5, 2009
    Last modified: October 1, 2014
    This is version 88 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. MGD cross-references
      Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
    2. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3