Q8K3W0 (BRE_MOUSE) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 29, 2013.
Version 77.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: BRCA1-A complex subunit BRE Alternative name(s): BRCA1/BRCA2-containing complex subunit 45 Brain and reproductive organ-expressed protein | ||
| Gene names |
| ||
| Organism | Mus musculus (Mouse) [Reference proteome] | ||
| Taxonomic identifier | 10090 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus › Mus![]() |
Protein attributes
| Sequence length | 383 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Component of the BRCA1-A complex, a complex that specifically recognizes 'Lys-63'-linked ubiquitinated histones H2A and H2AX at DNA lesions sites, leading to target the BRCA1-BARD1 heterodimer to sites of DNA damage at double-strand breaks (DSBs). The BRCA1-A complex also possesses deubiquitinase activity that specifically removes 'Lys-63'-linked ubiquitin on histones H2A and H2AX. In the BRCA1-A complex, it acts as an adapter that bridges the interaction between BABAM1/NBA1 and the rest of the complex, thereby being required for the complex integrity and modulating the E3 ubiquitin ligase activity of the BRCA1-BARD1 heterodimer. Probably also plays a role as a component of the BRISC complex, a multiprotein complex that specifically cleaves 'Lys-63'-linked ubiquitin By similarity. May regulate TNF-alpha signaling through its interactions with TNFRSF1A. Ref.4 |
| Subunit structure | Component of the BRCA1-A complex, at least composed of the BRCA1, BARD1, UIMC1/RAP80, FAM175A/Abraxas, BRCC3/BRCC36, BRE/BRCC45 and BABAM1/NBA1. In the BRCA1-A complex, interacts directly with FAM175A/Abraxas, BRCC3/BRCC36 and BABAM1/NBA1. Binds polyubiquitin. Component of the BRISC complex, at least composed of the FAM175B/ABRO1, BRCC3/BRCC36, BRE/BRCC45 and BABAM1/NBA1. Component of the BRCA1/BRCA2 containing complex (BRCC), which also contains BRCA1, BRCA2, BARD1, BRCC3/BRCC36 and RAD51. BRCC is a ubiquitin E3 ligase complex that enhances cellular survival following DNA damage. May interact with FAS By similarity. Interacts with TNFRSF1A. Ref.4 |
| Subcellular location | Cytoplasm By similarity. Nucleus By similarity. Note: Localizes at sites of DNA damage at double-strand breaks (DSBs) By similarity. |
| Tissue specificity | Expressed in brain, heart, kidney, liver, lung, testis, germinal center B-cells and various mouse cell lines. Ref.1 Ref.5 |
| Domain | Contains 2 ubiquitin-conjugating enzyme family-like (UEV-like) regions. These regions lack the critical Cys residues required for ubiquitination but retain the ability to bind ubiquitin By similarity. |
| Sequence similarities | Belongs to the BRE family. |
| Sequence caution | The sequence BAC34385.1 differs from that shown. Reason: Probable cloning artifact. |
Ontologies
Alternative products
| This entry describes 5 isoforms produced by alternative splicing. [Align] [Select] Note: Additional isoforms may exist. | ||||||
| Isoform 2 Ref.1 (identifier: Q8K3W0-2) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 1 Ref.1 (identifier: Q8K3W0-1) Also known as: I; The sequence of this isoform differs from the canonical sequence as follows: 27-43: VGLDATNCLRITDLKSG → IHEKGPSQKLSFKSCSYHLPMCACNEWYGVPDLEKASYLWRKKENHLPLEKGQN | ||||||
| Isoform 3 (identifier: Q8K3W0-4) Also known as: II,II3+; The sequence of this isoform differs from the canonical sequence as follows: 1-138: Missing. | ||||||
| Isoform 4 Ref.1 (identifier: Q8K3W0-5) Also known as: IV; The sequence of this isoform differs from the canonical sequence as follows: 1-43: MSPEIALNRI...CLRITDLKSG → MCACNEWYGVPDLEKASYLWRKKENHLPLEKGQN | ||||||
| Isoform 5 (identifier: Q8K3W0-6) Also known as: III; The sequence of this isoform differs from the canonical sequence as follows: 1-69: MSPEIALNRISPMLSPFISSVVRNGKVGLDATNCLRITDLKSGCTSLTPGPNCDRFKLHIPYAGETLKW → MCACR |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 383 | 383 | BRCA1-A complex subunit BRE | PRO_0000224190 | |||||
Regions | |||||||||
| Region | 30 – 147 | 118 | UEV-like 1 | ||||||
| Region | 275 – 364 | 90 | UEV-like 2 | ||||||
Amino acid modifications | |||||||||
| Modified residue | 1 | 1 | N-acetylmethionine By similarity | ||||||
| Modified residue | 2 | 1 | Phosphoserine By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 138 | 138 | Missing in isoform 3. | VSP_051952 | |||||
| Alternative sequence | 1 – 69 | 69 | MSPEI…ETLKW → MCACR in isoform 5. | VSP_037262 | |||||
| Alternative sequence | 1 – 43 | 43 | MSPEI…DLKSG → MCACNEWYGVPDLEKASYLW RKKENHLPLEKGQN in isoform 4. | VSP_037263 | |||||
| Alternative sequence | 27 – 43 | 17 | VGLDA…DLKSG → IHEKGPSQKLSFKSCSYHLP MCACNEWYGVPDLEKASYLW RKKENHLPLEKGQN in isoform 1. | VSP_051953 | |||||
Experimental info | |||||||||
| Sequence conflict | 105 | 1 | W → R in AAH61000. Ref.3 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Expression of a conserved mouse stress-modulating gene, Bre: comparison with the human ortholog." Ching A.K.K., Li Q., Lim P.L., Chan J.Y.-H., Chui Y.L. DNA Cell Biol. 22:497-504(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 3; 4 AND 5), TISSUE SPECIFICITY. Strain: BALB/c and C57BL/6 X CBA/N. Tissue: Heart. |
| [2] | "The transcriptional landscape of the mammalian genome." Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. Hayashizaki Y.Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Strain: C57BL/6J and NOD. Tissue: Embryo, Medulla oblongata and Spleen. |
| [3] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Strain: Czech II. Tissue: Kidney and Lung. |
| [4] | "BRE: a modulator of TNF-alpha action." Gu C., Castellino A., Chan J.Y.-H., Chao M.V. FASEB J. 12:1101-1108(1998) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, INTERACTION WITH TNFRSF1A. |
| [5] | "Expression of human BRE in multiple isoforms." Ching A.K.K., Li P.S., Li Q., Chan B.C.L., Chan J.Y.-H., Lim P.L., Pang J.C.S., Chui Y.L. Biochem. Biophys. Res. Commun. 288:535-545(2001) [PubMed] [Europe PMC] [Abstract] Cited for: TISSUE SPECIFICITY. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF440752 mRNA. Translation: AAL40809.1. AF527952 mRNA. Translation: AAM92774.1. AF527953 mRNA. Translation: AAM92775.1. AF527954 mRNA. Translation: AAM92776.1. AF527955 mRNA. Translation: AAM92777.1. AF538925 mRNA. Translation: AAN15148.1. AK050695 mRNA. Translation: BAC34385.1. Sequence problems. AK080991 mRNA. Translation: BAC38108.1. AK156929 mRNA. Translation: BAE33900.1. BC061000 mRNA. Translation: AAH61000.1. BC100565 mRNA. Translation: AAI00566.1. |
| IPI | IPI00128466. IPI00170162. IPI00400095. IPI00400287. IPI00400376. |
| RefSeq | NP_653124.1. NM_144541.1. NP_851796.1. NM_181279.1. NP_851797.1. NM_181280.1. NP_851798.1. NM_181281.1. NP_851799.1. NM_181282.1. |
| UniGene | Mm.482126. |
3D structure databases | |
| ModBase | Search... |
Proteomic databases | |
| PaxDb | Q8K3W0. |
| PRIDE | Q8K3W0. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENSMUST00000063813; ENSMUSP00000069133; ENSMUSG00000052139. ENSMUST00000071531; ENSMUSP00000071462; ENSMUSG00000052139. ENSMUST00000080598; ENSMUSP00000079434; ENSMUSG00000052139. ENSMUST00000114507; ENSMUSP00000110152; ENSMUSG00000052139. ENSMUST00000131995; ENSMUSP00000128351; ENSMUSG00000052139. |
| GeneID | 107976. |
| KEGG | mmu:107976. |
| UCSC | uc008wza.1. mouse. uc008wzb.1. mouse. uc008wzc.1. mouse. uc008wze.1. mouse. |
Organism-specific databases | |
| CTD | 9577. |
| MGI | MGI:1333875. Bre. |
Phylogenomic databases | |
| eggNOG | NOG71563. |
| GeneTree | ENSGT00390000004208. |
| HOVERGEN | HBG071492. |
| InParanoid | Q8CJ13. |
| KO | K12173. |
| OMA | FKTFVPQ. |
| OrthoDB | EOG4G7BZD. |
Gene expression databases | |
| ArrayExpress | Q8K3W0. |
| Bgee | Q8K3W0. |
| CleanEx | MM_BRE. |
| Genevestigator | Q8K3W0. |
| GermOnline | ENSMUSG00000052139. Mus musculus. |
Family and domain databases | |
| InterPro | IPR010358. Brain/reproduct-express_prot. [Graphical view] |
| Pfam | PF06113. BRE. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChiTaRS | BRE. mouse. |
| NextBio | 359811. |
| SOURCE | Search... |
Entry information
| Entry name | BRE_MOUSE | ||||||||
| Accession | Primary (citable) accession number: Q8K3W0 Secondary accession number(s): Q497G6 Q8VHN1 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
