Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q8K3W0

- BRE_MOUSE

UniProt

Q8K3W0 - BRE_MOUSE

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

BRCA1-A complex subunit BRE

Gene

Bre

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Component of the BRCA1-A complex, a complex that specifically recognizes 'Lys-63'-linked ubiquitinated histones H2A and H2AX at DNA lesions sites, leading to target the BRCA1-BARD1 heterodimer to sites of DNA damage at double-strand breaks (DSBs). The BRCA1-A complex also possesses deubiquitinase activity that specifically removes 'Lys-63'-linked ubiquitin on histones H2A and H2AX. In the BRCA1-A complex, it acts as an adapter that bridges the interaction between BABAM1/NBA1 and the rest of the complex, thereby being required for the complex integrity and modulating the E3 ubiquitin ligase activity of the BRCA1-BARD1 heterodimer. Probably also plays a role as a component of the BRISC complex, a multiprotein complex that specifically cleaves 'Lys-63'-linked ubiquitin (By similarity). May regulate TNF-alpha signaling through its interactions with TNFRSF1A.By similarity1 Publication

GO - Molecular functioni

  1. polyubiquitin binding Source: UniProtKB
  2. tumor necrosis factor receptor binding Source: UniProtKB

GO - Biological processi

  1. apoptotic process Source: UniProtKB-KW
  2. cellular response to DNA damage stimulus Source: UniProtKB
  3. chromatin modification Source: UniProtKB-KW
  4. double-strand break repair Source: UniProtKB
  5. G2 DNA damage checkpoint Source: UniProtKB
  6. positive regulation of DNA repair Source: UniProtKB
  7. response to ionizing radiation Source: UniProtKB
Complete GO annotation...

Keywords - Molecular functioni

Chromatin regulator

Keywords - Biological processi

Apoptosis, DNA damage, DNA repair

Names & Taxonomyi

Protein namesi
Recommended name:
BRCA1-A complex subunit BRE
Alternative name(s):
BRCA1/BRCA2-containing complex subunit 45
Brain and reproductive organ-expressed protein
Gene namesi
Name:BreImported
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
ProteomesiUP000000589: Chromosome 5

Organism-specific databases

MGIiMGI:1333875. Bre.

Subcellular locationi

Cytoplasm By similarity. Nucleus By similarity
Note: Localizes at sites of DNA damage at double-strand breaks (DSBs).By similarity

GO - Cellular componenti

  1. BRCA1-A complex Source: UniProtKB
  2. BRISC complex Source: UniProtKB
  3. cytoplasm Source: UniProtKB
  4. nuclear ubiquitin ligase complex Source: UniProtKB
  5. nucleus Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 383383BRCA1-A complex subunit BREPRO_0000224190Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei1 – 11N-acetylmethionineBy similarity
Modified residuei2 – 21PhosphoserineBy similarity

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

MaxQBiQ8K3W0.
PaxDbiQ8K3W0.
PRIDEiQ8K3W0.

Expressioni

Tissue specificityi

Expressed in brain, heart, kidney, liver, lung, testis, germinal center B-cells and various mouse cell lines.2 Publications

Gene expression databases

BgeeiQ8K3W0.
CleanExiMM_BRE.
ExpressionAtlasiQ8K3W0. baseline and differential.
GenevestigatoriQ8K3W0.

Interactioni

Subunit structurei

Component of the BRCA1-A complex, at least composed of the BRCA1, BARD1, UIMC1/RAP80, FAM175A/Abraxas, BRCC3/BRCC36, BRE/BRCC45 and BABAM1/NBA1. In the BRCA1-A complex, interacts directly with FAM175A/Abraxas, BRCC3/BRCC36 and BABAM1/NBA1. Binds polyubiquitin. Component of the BRISC complex, at least composed of the FAM175B/ABRO1, BRCC3/BRCC36, BRE/BRCC45 and BABAM1/NBA1. Component of the BRCA1/BRCA2 containing complex (BRCC), which also contains BRCA1, BRCA2, BARD1, BRCC3/BRCC36 and RAD51. BRCC is a ubiquitin E3 ligase complex that enhances cellular survival following DNA damage. May interact with FAS (By similarity). Interacts with TNFRSF1A.By similarity1 Publication

Protein-protein interaction databases

BioGridi223733. 3 interactions.

Structurei

3D structure databases

ProteinModelPortaliQ8K3W0.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni30 – 147118UEV-like 1Add
BLAST
Regioni275 – 36490UEV-like 2Add
BLAST

Domaini

Sequence similaritiesi

Belongs to the BRE family.Sequence Analysis

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiNOG71563.
GeneTreeiENSGT00390000004208.
HOVERGENiHBG071492.
InParanoidiQ8K3W0.
KOiK12173.
OMAiHIPAFPS.
OrthoDBiEOG7TJ3J9.
PhylomeDBiQ8K3W0.
TreeFamiTF328507.

Family and domain databases

InterProiIPR010358. Brain/reproduct-express_prot.
[Graphical view]
PfamiPF06113. BRE. 1 hit.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. Align

Note: Additional isoforms may exist.Curated

Isoform 21 Publication (identifier: Q8K3W0-2) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSPEIALNRI SPMLSPFISS VVRNGKVGLD ATNCLRITDL KSGCTSLTPG
60 70 80 90 100
PNCDRFKLHI PYAGETLKWD IIFNAQYPEL PPDFIFGEDA EFLPDPSALH
110 120 130 140 150
NLASWNPSNP ECLLLVVKEL VQQYHQFQCG RLRESSRLMF EYQTLLEEPQ
160 170 180 190 200
YGENMEIYAG KKNNWTGEFS ARFLLKLPVD FSNIPTYLLK DVNEDPGEDV
210 220 230 240 250
ALLSVSFEDT EATQVYPKLY LSPRIEHALG GSSALHIPAF PGGGCLIDYV
260 270 280 290 300
PQVCHLLTNK VQYVIQGYHK RREYIAAFLS HFGTGVVEYD AEGFTKLTLL
310 320 330 340 350
LMWKDFCFLV HIDLPLFFPR DQPTLTFQSV YHFTNSGQLY SQAQKNYPYS
360 370 380
PRWDGNEMAK RAKAYFKTFV PQFQEAAFAN GKL
Length:383
Mass (Da):43,545
Last modified:May 5, 2009 - v2
Checksum:i7BABA837A8AF82E6
GO
Isoform 11 Publication (identifier: Q8K3W0-1) [UniParc]FASTAAdd to Basket

Also known as: I1 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     27-43: VGLDATNCLRITDLKSG → IHEKGPSQKLSFKSCSYHLPMCACNEWYGVPDLEKASYLWRKKENHLPLEKGQN

Show »
Length:420
Mass (Da):48,089
Checksum:i1A9D634D162CE2A8
GO
Isoform 3 (identifier: Q8K3W0-4) [UniParc]FASTAAdd to Basket

Also known as: II, II3+

The sequence of this isoform differs from the canonical sequence as follows:
     1-138: Missing.

Show »
Length:245
Mass (Da):28,090
Checksum:i2F77E99B644BD4B4
GO
Isoform 4 (identifier: Q8K3W0-5) [UniParc]FASTAAdd to Basket

Also known as: IV

The sequence of this isoform differs from the canonical sequence as follows:
     1-43: MSPEIALNRI...CLRITDLKSG → MCACNEWYGVPDLEKASYLWRKKENHLPLEKGQN

Show »
Length:374
Mass (Da):42,994
Checksum:i6A60137DAF657C78
GO
Isoform 5 (identifier: Q8K3W0-6) [UniParc]FASTAAdd to Basket

Also known as: III

The sequence of this isoform differs from the canonical sequence as follows:
     1-69: MSPEIALNRISPMLSPFISSVVRNGKVGLDATNCLRITDLKSGCTSLTPGPNCDRFKLHIPYAGETLKW → MCACR

Show »
Length:319
Mass (Da):36,595
Checksum:i2AE2865E15A82E37
GO

Sequence cautioni

The sequence BAC34385.1 differs from that shown. Reason: Probable cloning artifact.

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti105 – 1051W → R in AAH61000. (PubMed:15489334)Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 138138Missing in isoform 3. 1 PublicationVSP_051952Add
BLAST
Alternative sequencei1 – 6969MSPEI…ETLKW → MCACR in isoform 5. 1 PublicationVSP_037262Add
BLAST
Alternative sequencei1 – 4343MSPEI…DLKSG → MCACNEWYGVPDLEKASYLW RKKENHLPLEKGQN in isoform 4. 1 PublicationVSP_037263Add
BLAST
Alternative sequencei27 – 4317VGLDA…DLKSG → IHEKGPSQKLSFKSCSYHLP MCACNEWYGVPDLEKASYLW RKKENHLPLEKGQN in isoform 1. 1 PublicationVSP_051953Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF440752 mRNA. Translation: AAL40809.1.
AF527952 mRNA. Translation: AAM92774.1.
AF527953 mRNA. Translation: AAM92775.1.
AF527954 mRNA. Translation: AAM92776.1.
AF527955 mRNA. Translation: AAM92777.1.
AF538925 mRNA. Translation: AAN15148.1.
AK050695 mRNA. Translation: BAC34385.1. Sequence problems.
AK080991 mRNA. Translation: BAC38108.1.
AK156929 mRNA. Translation: BAE33900.1.
BC061000 mRNA. Translation: AAH61000.1.
BC100565 mRNA. Translation: AAI00566.1.
CCDSiCCDS19188.1. [Q8K3W0-2]
CCDS19189.1. [Q8K3W0-1]
CCDS39058.1. [Q8K3W0-5]
CCDS39059.1. [Q8K3W0-4]
CCDS51461.1. [Q8K3W0-6]
RefSeqiNP_653124.1. NM_144541.1. [Q8K3W0-2]
NP_851796.1. NM_181279.1. [Q8K3W0-1]
NP_851797.1. NM_181280.1. [Q8K3W0-5]
NP_851798.1. NM_181281.1. [Q8K3W0-6]
NP_851799.1. NM_181282.1. [Q8K3W0-4]
UniGeneiMm.482126.

Genome annotation databases

EnsembliENSMUST00000063813; ENSMUSP00000069133; ENSMUSG00000052139. [Q8K3W0-1]
ENSMUST00000071531; ENSMUSP00000071462; ENSMUSG00000052139. [Q8K3W0-5]
ENSMUST00000080598; ENSMUSP00000079434; ENSMUSG00000052139. [Q8K3W0-2]
ENSMUST00000114507; ENSMUSP00000110152; ENSMUSG00000052139. [Q8K3W0-6]
ENSMUST00000131995; ENSMUSP00000128351; ENSMUSG00000052139. [Q8K3W0-4]
GeneIDi107976.
KEGGimmu:107976.
UCSCiuc008wza.1. mouse. [Q8K3W0-2]
uc008wzb.1. mouse. [Q8K3W0-1]
uc008wzc.1. mouse. [Q8K3W0-5]
uc008wze.1. mouse. [Q8K3W0-6]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF440752 mRNA. Translation: AAL40809.1 .
AF527952 mRNA. Translation: AAM92774.1 .
AF527953 mRNA. Translation: AAM92775.1 .
AF527954 mRNA. Translation: AAM92776.1 .
AF527955 mRNA. Translation: AAM92777.1 .
AF538925 mRNA. Translation: AAN15148.1 .
AK050695 mRNA. Translation: BAC34385.1 . Sequence problems.
AK080991 mRNA. Translation: BAC38108.1 .
AK156929 mRNA. Translation: BAE33900.1 .
BC061000 mRNA. Translation: AAH61000.1 .
BC100565 mRNA. Translation: AAI00566.1 .
CCDSi CCDS19188.1. [Q8K3W0-2 ]
CCDS19189.1. [Q8K3W0-1 ]
CCDS39058.1. [Q8K3W0-5 ]
CCDS39059.1. [Q8K3W0-4 ]
CCDS51461.1. [Q8K3W0-6 ]
RefSeqi NP_653124.1. NM_144541.1. [Q8K3W0-2 ]
NP_851796.1. NM_181279.1. [Q8K3W0-1 ]
NP_851797.1. NM_181280.1. [Q8K3W0-5 ]
NP_851798.1. NM_181281.1. [Q8K3W0-6 ]
NP_851799.1. NM_181282.1. [Q8K3W0-4 ]
UniGenei Mm.482126.

3D structure databases

ProteinModelPortali Q8K3W0.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 223733. 3 interactions.

Proteomic databases

MaxQBi Q8K3W0.
PaxDbi Q8K3W0.
PRIDEi Q8K3W0.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENSMUST00000063813 ; ENSMUSP00000069133 ; ENSMUSG00000052139 . [Q8K3W0-1 ]
ENSMUST00000071531 ; ENSMUSP00000071462 ; ENSMUSG00000052139 . [Q8K3W0-5 ]
ENSMUST00000080598 ; ENSMUSP00000079434 ; ENSMUSG00000052139 . [Q8K3W0-2 ]
ENSMUST00000114507 ; ENSMUSP00000110152 ; ENSMUSG00000052139 . [Q8K3W0-6 ]
ENSMUST00000131995 ; ENSMUSP00000128351 ; ENSMUSG00000052139 . [Q8K3W0-4 ]
GeneIDi 107976.
KEGGi mmu:107976.
UCSCi uc008wza.1. mouse. [Q8K3W0-2 ]
uc008wzb.1. mouse. [Q8K3W0-1 ]
uc008wzc.1. mouse. [Q8K3W0-5 ]
uc008wze.1. mouse. [Q8K3W0-6 ]

Organism-specific databases

CTDi 9577.
MGIi MGI:1333875. Bre.

Phylogenomic databases

eggNOGi NOG71563.
GeneTreei ENSGT00390000004208.
HOVERGENi HBG071492.
InParanoidi Q8K3W0.
KOi K12173.
OMAi HIPAFPS.
OrthoDBi EOG7TJ3J9.
PhylomeDBi Q8K3W0.
TreeFami TF328507.

Miscellaneous databases

ChiTaRSi BRE. mouse.
NextBioi 359811.
PROi Q8K3W0.
SOURCEi Search...

Gene expression databases

Bgeei Q8K3W0.
CleanExi MM_BRE.
ExpressionAtlasi Q8K3W0. baseline and differential.
Genevestigatori Q8K3W0.

Family and domain databases

InterProi IPR010358. Brain/reproduct-express_prot.
[Graphical view ]
Pfami PF06113. BRE. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Expression of a conserved mouse stress-modulating gene, Bre: comparison with the human ortholog."
    Ching A.K.K., Li Q., Lim P.L., Chan J.Y.-H., Chui Y.L.
    DNA Cell Biol. 22:497-504(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 3; 4 AND 5), TISSUE SPECIFICITY.
    Strain: BALB/cImported and C57BL/6 X CBA/N.
    Tissue: HeartImported.
  2. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Strain: C57BL/6JImported and NODImported.
    Tissue: EmbryoImported, Medulla oblongataImported and SpleenImported.
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Strain: Czech II.
    Tissue: KidneyImported and Lung.
  4. "BRE: a modulator of TNF-alpha action."
    Gu C., Castellino A., Chan J.Y.-H., Chao M.V.
    FASEB J. 12:1101-1108(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, INTERACTION WITH TNFRSF1A.
  5. Cited for: TISSUE SPECIFICITY.

Entry informationi

Entry nameiBRE_MOUSE
AccessioniPrimary (citable) accession number: Q8K3W0
Secondary accession number(s): Q497G6
, Q6P8Z2, Q8BKU1, Q8CJ13, Q8JZP0, Q8K3V9, Q8VHN1
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 21, 2006
Last sequence update: May 5, 2009
Last modified: October 29, 2014
This is version 89 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3