Q8K3R3 (PLCD4_MOUSE) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 93.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-4 EC=3.1.4.11 Alternative name(s): Phosphoinositide phospholipase C-delta-4 Phospholipase C-delta-4 Short name=PLC-delta-4 | ||||
| Gene names |
| ||||
| Organism | Mus musculus (Mouse) [Reference proteome] | ||||
| Taxonomic identifier | 10090 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus › Mus![]() |
Protein attributes
| Sequence length | 807 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Hydrolyzes the phosphatidylinositol 4,5-bisphosphate (PIP2) to generate 2 second messenger molecules diacylglycerol (DAG) and inositol 1,4,5-trisphosphate (IP3). DAG mediates the activation of protein kinase C (PKC), while IP3 releases Ca2+ from intracellular stores. Required for acrosome reaction in sperm during fertilization, probably by acting as an important enzyme for intracellular Ca2+ mobilization in the zona pellucida-induced acrosome reaction. May play a role in cell growth. Modulates the liver regeneration in cooperation with nuclear PKC. Overexpression up-regulates the Erk signaling pathway and proliferation. Ref.5 Ref.6 Ref.8 |
| Catalytic activity | 1-phosphatidyl-1D-myo-inositol 4,5-bisphosphate + H2O = 1D-myo-inositol 1,4,5-trisphosphate + diacylglycerol. |
| Cofactor | Binds 3 calcium ions per subunit. Two of the calcium ions are bound to the C2 domain By similarity. |
| Subunit structure | Interacts with GRIP1. Ref.7 |
| Subcellular location | Membrane; Peripheral membrane protein By similarity. Nucleus By similarity. Cytoplasm By similarity. Endoplasmic reticulum By similarity. Note: Localizes primarily to intracellular membranes mostly to the endoplasmic reticulum By similarity. |
| Induction | By treatment with growth factors such as bradykinin, lysophosphatidic acid, and Ca2+ ionophore in addition to serum. Ref.4 |
| Domain | The PDZ-binding motif mediates the interaction with GRIP1. The C2 domain mediates pre-localization to the membrane prior to Ca2+ import and non-selective Ca2+-mediated targeting to various cellular membranes By similarity. The PH domain is not a critical determinant of the membrane localization By similarity. |
| Disruption phenotype | Mice are either sterile or produce few small litters. In these mice, fewer eggs become activated and the Ca2+ transients associated with fertilization are absent or delayed. Sperm are unable to initiate the acrosome reaction. Ref.5 |
| Sequence similarities | Contains 1 C2 domain. Contains 3 EF-hand domains. Contains 1 PH domain. Contains 1 PI-PLC X-box domain. Contains 1 PI-PLC Y-box domain. |
Ontologies
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q8K3R3-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q8K3R3-2) The sequence of this isoform differs from the canonical sequence as follows: 493-524: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: Q8K3R3-3) The sequence of this isoform differs from the canonical sequence as follows: 493-524: Missing. 773-807: GYRHVSLLSRDGTSLNPASIFVYTCMQEDLDMDEP → EMALASIQLP...LKIQSQPKDQ | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 4 (identifier: Q8K3R3-4) The sequence of this isoform differs from the canonical sequence as follows: 494-496: MKC → SQD 497-807: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 807 | 807 | 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-4 | PRO_0000306826 | |||||
Regions | |||||||||
| Domain | 16 – 124 | 109 | PH | ||||||
| Domain | 134 – 169 | 36 | EF-hand 1 | ||||||
| Domain | 170 – 205 | 36 | EF-hand 2 | ||||||
| Domain | 203 – 237 | 35 | EF-hand 3 | ||||||
| Domain | 290 – 435 | 146 | PI-PLC X-box | ||||||
| Domain | 538 – 654 | 117 | PI-PLC Y-box | ||||||
| Domain | 659 – 764 | 106 | C2 | ||||||
| Calcium binding | 147 – 158 | 12 | 1 Potential | ||||||
| Calcium binding | 183 – 194 | 12 | 2 Potential | ||||||
| Region | 26 – 53 | 28 | Substrate binding By similarity | ||||||
| Motif | 776 – 779 | 4 | PDZ-binding | ||||||
| Compositional bias | 445 – 456 | 12 | Poly-Glu | ||||||
Sites | |||||||||
| Active site | 305 | 1 | By similarity | ||||||
| Active site | 350 | 1 | By similarity | ||||||
| Metal binding | 306 | 1 | Calcium 1; catalytic By similarity | ||||||
| Metal binding | 335 | 1 | Calcium 1; catalytic By similarity | ||||||
| Metal binding | 337 | 1 | Calcium 1; catalytic By similarity | ||||||
| Metal binding | 384 | 1 | Calcium 1; catalytic By similarity | ||||||
| Metal binding | 697 | 1 | Calcium 2 By similarity | ||||||
| Metal binding | 721 | 1 | Calcium 2 By similarity | ||||||
| Metal binding | 750 | 1 | Calcium 3 By similarity | ||||||
| Metal binding | 751 | 1 | Calcium 3; via carbonyl oxygen By similarity | ||||||
| Binding site | 433 | 1 | Substrate By similarity | ||||||
| Binding site | 435 | 1 | Substrate By similarity | ||||||
| Binding site | 567 | 1 | Substrate By similarity | ||||||
| Binding site | 594 | 1 | Substrate By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 493 – 524 | 32 | Missing in isoform 2 and isoform 3. | VSP_028503 | |||||
| Alternative sequence | 494 – 496 | 3 | MKC → SQD in isoform 4. | VSP_028504 | |||||
| Alternative sequence | 497 – 807 | 311 | Missing in isoform 4. | VSP_028505 | |||||
| Alternative sequence | 773 – 807 | 35 | GYRHV…DMDEP → EMALASIQLPSLYTPACRKT WIWMSPEKHREGLEEQSTDA QSFPTYNFLKIQSQPKDQ in isoform 3. | VSP_028506 | |||||
Experimental info | |||||||||
| Sequence conflict | 180 | 1 | Q → R in BAE24292. Ref.2 | ||||||
| Sequence conflict | 310 | 1 | V → A in AAH66156. Ref.3 | ||||||
| Sequence conflict | 372 | 1 | F → L in AAH66156. Ref.3 | ||||||
| Sequence conflict | 445 | 1 | Missing in BAE24292. Ref.2 | ||||||
| Sequence conflict | 470 | 1 | L → F in AAK61537. Ref.1 | ||||||
| Sequence conflict | 594 | 1 | R → C in AAH66156. Ref.3 | ||||||
| Sequence conflict | 653 | 1 | L → V in AAK61537. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Molecular cloning of PLC delta4." Kim J., Kim H., Lee K.-H. Submitted (MAY-2001) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Testis. |
| [2] | "The transcriptional landscape of the mammalian genome." Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. Hayashizaki Y.Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3 AND 4). Strain: C57BL/6J. Tissue: Corpora quadrigemina, Hypothalamus and Testis. |
| [3] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Strain: CD-1. Tissue: Neural stem cell. |
| [4] | "Growth factor-induced promoter activation of murine phospholipase C delta4 gene." Fukami K., Takenaka K., Nagano K., Takenawa T. Eur. J. Biochem. 267:28-36(2000) [PubMed] [Europe PMC] [Abstract] Cited for: INDUCTION. |
| [5] | "Requirement of phospholipase Cdelta4 for the zona pellucida-induced acrosome reaction." Fukami K., Nakao K., Inoue T., Kataoka Y., Kurokawa M., Fissore R.A., Nakamura K., Katsuki M., Mikoshiba K., Yoshida N., Takenawa T. Science 292:920-923(2001) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, DISRUPTION PHENOTYPE. |
| [6] | "Phospholipase Cdelta4 is required for Ca2+ mobilization essential for acrosome reaction in sperm." Fukami K., Yoshida M., Inoue T., Kurokawa M., Fissore R.A., Yoshida N., Mikoshiba K., Takenawa T. J. Cell Biol. 161:79-88(2003) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION. |
| [7] | "Phospholipase Cdelta4 associates with glutamate receptor interacting protein 1 in testis." Irino Y., Ichinohe M., Nakamura Y., Nakahara M., Fukami K. J. Biochem. 138:451-456(2005) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH GRIP1. |
| [8] | "Disruption of phospholipase Cdelta4 gene modulates the liver regeneration in cooperation with nuclear protein kinase C." Akutagawa A., Fukami K., Banno Y., Takenawa T., Kannagi R., Yokoyama Y., Oda K., Nagino M., Nimura Y., Yoshida S., Tamiya-Koizumi K. J. Biochem. 140:619-625(2006) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AY033991 mRNA. Translation: AAK61537.1. AK016945 mRNA. Translation: BAB30513.1. AK039149 mRNA. Translation: BAC30256.1. AK140231 mRNA. Translation: BAE24292.1. BC066156 mRNA. Translation: AAH66156.1. |
| IPI | IPI00322551. IPI00652756. IPI00831343. IPI00831599. |
| RefSeq | NP_001074925.1. NM_001081456.1. NP_683739.2. NM_148937.2. |
| UniGene | Mm.290731. |
3D structure databases | |
| HSSP | HSSP built from PDB template 1QAS based on UniProtKB P10688. |
| ProteinModelPortal | Q8K3R3. |
| SMR | Q8K3R3. Positions 9-453, 536-800. |
| ModBase | Search... |
PTM databases | |
| PhosphoSite | Q8K3R3. |
Proteomic databases | |
| PaxDb | Q8K3R3. |
| PRIDE | Q8K3R3. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENSMUST00000027362; ENSMUSP00000027362; ENSMUSG00000026173. ENSMUST00000067916; ENSMUSP00000064413; ENSMUSG00000026173. ENSMUST00000113745; ENSMUSP00000109374; ENSMUSG00000026173. ENSMUST00000113747; ENSMUSP00000109376; ENSMUSG00000026173. ENSMUST00000113749; ENSMUSP00000109378; ENSMUSG00000026173. ENSMUST00000113750; ENSMUSP00000109379; ENSMUSG00000026173. |
| GeneID | 18802. |
| KEGG | mmu:18802. |
| UCSC | uc007bmg.1. mouse. uc007bmh.1. mouse. uc007bmi.1. mouse. uc011wnb.1. mouse. |
Organism-specific databases | |
| CTD | 84812. |
| MGI | MGI:107469. Plcd4. |
Phylogenomic databases | |
| eggNOG | NOG149692. |
| GeneTree | ENSGT00700000104181. |
| HOGENOM | HOG000006871. |
| HOVERGEN | HBG053610. |
| InParanoid | Q8K3R3. |
| KO | K05857. |
| OMA | VEMDEEY. |
| OrthoDB | EOG4868BW. |
Gene expression databases | |
| ArrayExpress | Q8K3R3. |
| Bgee | Q8K3R3. |
| CleanEx | MM_PLCD4. |
| Genevestigator | Q8K3R3. |
Family and domain databases | |
| Gene3D | 1.10.238.10. 2 hits. 2.30.29.30. 1 hit. 3.20.20.190. 2 hits. |
| InterPro | IPR000008. C2_Ca-dep. IPR008973. C2_Ca/lipid-bd_dom_CaLB. IPR018029. C2_membr_targeting. IPR011992. EF-hand-like_dom. IPR002048. EF_hand_dom. IPR011993. PH_like_dom. IPR001192. Pinositol_PLipase_C. IPR017946. PLC-like_Pdiesterase_TIM-brl. IPR001849. Pleckstrin_homology. IPR015359. PLipase_C_EF-hand-like. IPR000909. PLipase_C_PInositol-sp_X_dom. IPR001711. PLipase_C_Pinositol-sp_Y. [Graphical view] |
| PANTHER | PTHR10336. PTHR10336. 1 hit. |
| Pfam | PF00168. C2. 1 hit. PF09279. efhand_like. 1 hit. PF00169. PH. 1 hit. PF00388. PI-PLC-X. 1 hit. PF00387. PI-PLC-Y. 1 hit. [Graphical view] |
| PRINTS | PR00390. PHPHLIPASEC. |
| SMART | SM00239. C2. 1 hit. SM00054. EFh. 3 hits. SM00233. PH. 1 hit. SM00148. PLCXc. 1 hit. SM00149. PLCYc. 1 hit. [Graphical view] |
| SUPFAM | SSF49562. C2_CaLB. 1 hit. SSF51695. PLC-like_Pdiesterase_TIM-brl. 1 hit. |
| PROSITE | PS50004. C2. 1 hit. PS00018. EF_HAND_1. False negative. PS50222. EF_HAND_2. 3 hits. PS50003. PH_DOMAIN. 1 hit. PS50007. PIPLC_X_DOMAIN. 1 hit. PS50008. PIPLC_Y_DOMAIN. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 295100. |
| SOURCE | Search... |
Entry information
| Entry name | PLCD4_MOUSE | ||||||||
| Accession | Primary (citable) accession number: Q8K3R3 Secondary accession number(s): Q3USN9 Q9CUC1 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
