Q8K1N2 (PHLB2_MOUSE) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 82.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Pleckstrin homology-like domain family B member 2 Alternative name(s): Protein LL5-beta | ||||
| Gene names |
| ||||
| Organism | Mus musculus (Mouse) [Reference proteome] | ||||
| Taxonomic identifier | 10090 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus › Mus![]() |
Protein attributes
| Sequence length | 1249 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Seems to be involved in the assembly of the postsynaptic apparatus. May play a role in acetyl-choline receptor (AChR) aggregation in the postsynaptic membrane. Ref.5 |
| Subunit structure | Interacts with FLNC By similarity. |
| Subcellular location | Cytoplasm By similarity. Membrane; Peripheral membrane protein By similarity. Note: Translocates to the plasma membrane at high levels of PtdIns(3,4,5)P3. At low levels of PtdIns(3,4,5)P3 is translocated to vesicular compartments By similarity. |
| Tissue specificity | Expressed at postsynaptic membranes of skeletal neuromuscular junctions (at protein level). Ref.5 |
| Developmental stage | In synapses, is expressed at embryonic day 15 and colocalizes with acetyl-choline receptor at prenatal day 4. Expression decreases in adult. Ref.5 |
| Domain | The PH domain mediates the binding to phosphoinositides By similarity. |
| Sequence similarities | Contains 1 PH domain. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cytoplasm Membrane |
| Coding sequence diversity | Alternative splicing |
| Domain | Coiled coil |
| PTM | Phosphoprotein |
| Technical term | Complete proteome Direct protein sequencing Reference proteome |
| Gene Ontology (GO) | |
| Cellular_component | cytoplasm Inferred from electronic annotation. Source: UniProtKB-SubCell intermediate filament cytoskeletonInferred from electronic annotation. Source: Compara plasma membraneInferred from electronic annotation. Source: Compara |
| Molecular_function | phospholipid binding Inferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q8K1N2-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q8K1N2-2) The sequence of this isoform differs from the canonical sequence as follows: 866-873: VSQPQSSE → HRTAVYSGFMSPSTLSPSVTEPSSATWPEVMTTSVDPFPLNDTPPPLPAKKHRRQQPQEQQ |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1249 | 1249 | Pleckstrin homology-like domain family B member 2 | PRO_0000053895 | |||||
Regions | |||||||||
| Domain | 1139 – 1242 | 104 | PH | ||||||
| Coiled coil | 580 – 692 | 113 | Potential | ||||||
| Coiled coil | 718 – 803 | 86 | Potential | ||||||
| Coiled coil | 1028 – 1094 | 67 | Potential | ||||||
| Compositional bias | 37 – 416 | 380 | Ser-rich | ||||||
Amino acid modifications | |||||||||
| Modified residue | 71 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 73 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 156 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 333 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 380 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 383 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 389 | 1 | Phosphoserine Ref.6 | ||||||
| Modified residue | 411 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 465 | 1 | Phosphoserine Ref.8 Ref.9 | ||||||
| Modified residue | 486 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 510 | 1 | Phosphoserine Ref.8 Ref.9 | ||||||
| Modified residue | 546 | 1 | Phosphothreonine By similarity | ||||||
| Modified residue | 570 | 1 | Phosphothreonine By similarity | ||||||
| Modified residue | 894 | 1 | Phosphothreonine Ref.7 | ||||||
| Modified residue | 976 | 1 | Phosphoserine Ref.7 | ||||||
Natural variations | |||||||||
| Alternative sequence | 866 – 873 | 8 | VSQPQSSE → HRTAVYSGFMSPSTLSPSVT EPSSATWPEVMTTSVDPFPL NDTPPPLPAKKHRRQQPQEQ Q in isoform 2. | VSP_016746 | |||||
Experimental info | |||||||||
| Sequence conflict | 112 | 1 | S → I in AAH50915. Ref.2 | ||||||
| Sequence conflict | 112 | 1 | S → I in AAH60683. Ref.2 | ||||||
| Sequence conflict | 504 | 1 | R → M in AAM33635. Ref.1 | ||||||
| Sequence conflict | 634 | 1 | A → S in BAE38105. Ref.3 | ||||||
| Sequence conflict | 807 | 1 | Y → D in AAM33635. Ref.1 | ||||||
| Sequence conflict | 1127 | 1 | H → P in AAM33635. Ref.1 | ||||||
| Sequence conflict | 1138 | 1 | T → P in AAM33635. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | Guo J.H., Yu L. Submitted (APR-2002) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Strain: BALB/c. |
| [2] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Strain: C57BL/6. Tissue: Brain. |
| [3] | "The transcriptional landscape of the mammalian genome." Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. Hayashizaki Y.Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-793 (ISOFORM 1). Strain: C57BL/6J. Tissue: Spleen. |
| [4] | Lubec G., Kang S.U. Submitted (APR-2007) to UniProtKB Cited for: PROTEIN SEQUENCE OF 570-579 AND 698-705, MASS SPECTROMETRY. Strain: C57BL/6. Tissue: Brain. |
| [5] | "LL5beta: a regulator of postsynaptic differentiation identified in a screen for synaptically enriched transcripts at the neuromuscular junction." Kishi M., Kummer T.T., Eglen S.J., Sanes J.R. J. Cell Biol. 169:355-366(2005) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, TISSUE SPECIFICITY, DEVELOPMENTAL STAGE. |
| [6] | "Protein phosphorylation and expression profiling by Yin-yang multidimensional liquid chromatography (Yin-yang MDLC) mass spectrometry." Dai J., Jin W.-H., Sheng Q.-H., Shieh C.-H., Wu J.-R., Zeng R. J. Proteome Res. 6:250-262(2007) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-389, MASS SPECTROMETRY. Tissue: Liver. |
| [7] | "Large-scale phosphorylation analysis of mouse liver." Villen J., Beausoleil S.A., Gerber S.A., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 104:1488-1493(2007) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-894 AND SER-976, MASS SPECTROMETRY. Tissue: Liver. |
| [8] | "Solid tumor proteome and phosphoproteome analysis by high resolution mass spectrometry." Zanivan S., Gnad F., Wickstroem S.A., Geiger T., Macek B., Cox J., Faessler R., Mann M. J. Proteome Res. 7:5314-5326(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-465 AND SER-510, MASS SPECTROMETRY. Tissue: Melanoma. |
| [9] | "Large scale localization of protein phosphorylation by use of electron capture dissociation mass spectrometry." Sweet S.M., Bailey C.M., Cunningham D.L., Heath J.K., Cooper H.J. Mol. Cell. Proteomics 8:904-912(2009) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-465 AND SER-510, MASS SPECTROMETRY. Tissue: Embryonic fibroblast. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF506821 mRNA. Translation: AAM33635.1. BC050915 mRNA. Translation: AAH50915.1. BC060683 mRNA. Translation: AAH60683.1. AK049595 mRNA. Translation: BAC33833.1. AK165251 mRNA. Translation: BAE38105.1. |
| IPI | IPI00330773. IPI00403827. |
| RefSeq | NP_001239371.1. NM_001252442.1. NP_700461.2. NM_153412.4. |
| UniGene | Mm.211477. |
3D structure databases | |
| ProteinModelPortal | Q8K1N2. |
| SMR | Q8K1N2. Positions 1144-1237. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q8K1N2. 1 interaction. |
| STRING | 10090.ENSMUSP00000075672. |
PTM databases | |
| PhosphoSite | Q8K1N2. |
Proteomic databases | |
| PaxDb | Q8K1N2. |
| PRIDE | Q8K1N2. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENSMUST00000036355; ENSMUSP00000046496; ENSMUSG00000033149. ENSMUST00000076333; ENSMUSP00000075672; ENSMUSG00000033149. |
| GeneID | 208177. |
| KEGG | mmu:208177. |
| UCSC | uc007zjb.2. mouse. uc012agj.1. mouse. |
Organism-specific databases | |
| CTD | 90102. |
| MGI | MGI:2444981. Phldb2. |
Phylogenomic databases | |
| eggNOG | NOG86245. |
| GeneTree | ENSGT00530000063148. |
| HOGENOM | HOG000286004. |
| HOVERGEN | HBG082124. |
| OMA | LNSFHYP. |
| OrthoDB | EOG4FJ881. |
Gene expression databases | |
| ArrayExpress | Q8K1N2. |
| Bgee | Q8K1N2. |
| Genevestigator | Q8K1N2. |
| GermOnline | ENSMUSG00000033149. Mus musculus. |
Family and domain databases | |
| Gene3D | 2.30.29.30. 1 hit. |
| InterPro | IPR011993. PH_like_dom. IPR001849. Pleckstrin_homology. [Graphical view] |
| Pfam | PF00169. PH. 1 hit. [Graphical view] |
| SMART | SM00233. PH. 1 hit. [Graphical view] |
| PROSITE | PS50003. PH_DOMAIN. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 372202. |
| SOURCE | Search... |
Entry information
| Entry name | PHLB2_MOUSE | ||||||||
| Accession | Primary (citable) accession number: Q8K1N2 Secondary accession number(s): Q3TNI3, Q80Y16, Q8BKV3 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
