SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q8JZZ7

- LPHN2_MOUSE

UniProt

Q8JZZ7 - LPHN2_MOUSE

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Latrophilin-2

Gene
Lphn2, Kiaa0786
Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 4 out of 5 - Experimental evidence at protein leveli

Functioni

Calcium-independent receptor of low affinity for alpha-latrotoxin, an excitatory neurotoxin present in black widow spider venom which triggers massive exocytosis from neurons and neuroendocrine cells. Receptor propably implicated in the regulation of exocytosis By similarity.

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sitei299 – 3002Cleavage By similarity

GO - Molecular functioni

  1. G-protein coupled receptor activity Source: UniProtKB-KW

GO - Biological processi

  1. neuropeptide signaling pathway Source: InterPro
Complete GO annotation...

Keywords - Molecular functioni

G-protein coupled receptor, Receptor, Transducer

Protein family/group databases

MEROPSiS63.012.

Names & Taxonomyi

Protein namesi
Recommended name:
Latrophilin-2
Alternative name(s):
Calcium-independent alpha-latrotoxin receptor 2
Short name:
CIRL-2
Gene namesi
Name:Lphn2
Synonyms:Kiaa0786
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
ProteomesiUP000000589: Unplaced

Organism-specific databases

MGIiMGI:2139714. Lphn2.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini‹1 – 326›326Extracellular Reviewed predictionAdd
BLAST
Transmembranei327 – 34721Helical; Name=1; Reviewed predictionAdd
BLAST
Topological domaini348 – 3558Cytoplasmic Reviewed prediction
Transmembranei356 – 37621Helical; Name=2; Reviewed predictionAdd
BLAST
Topological domaini377 – 3826Extracellular Reviewed prediction
Transmembranei383 – 40321Helical; Name=3; Reviewed predictionAdd
BLAST
Topological domaini404 – 42623Cytoplasmic Reviewed predictionAdd
BLAST
Transmembranei427 – 44721Helical; Name=4; Reviewed predictionAdd
BLAST
Topological domaini448 – 46518Extracellular Reviewed predictionAdd
BLAST
Transmembranei466 – 48621Helical; Name=5; Reviewed predictionAdd
BLAST
Topological domaini487 – 51226Cytoplasmic Reviewed predictionAdd
BLAST
Transmembranei513 – 53321Helical; Name=6; Reviewed predictionAdd
BLAST
Topological domaini534 – 5374Extracellular Reviewed prediction
Transmembranei538 – 55821Helical; Name=7; Reviewed predictionAdd
BLAST
Topological domaini559 – 891333Cytoplasmic Reviewed predictionAdd
BLAST

GO - Cellular componenti

  1. integral component of membrane Source: UniProtKB-KW
  2. plasma membrane Source: UniProtKB-SubCell
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini‹1 – 891›891Latrophilin-2PRO_0000070343Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi8 – 81N-linked (GlcNAc...) Reviewed prediction
Glycosylationi104 – 1041N-linked (GlcNAc...) Reviewed prediction
Glycosylationi206 – 2061N-linked (GlcNAc...)2 Publications
Glycosylationi219 – 2191N-linked (GlcNAc...) Reviewed prediction
Glycosylationi262 – 2621N-linked (GlcNAc...) Reviewed prediction
Glycosylationi267 – 2671N-linked (GlcNAc...) Reviewed prediction
Glycosylationi288 – 2881N-linked (GlcNAc...) Reviewed prediction
Modified residuei806 – 8061Phosphoserine1 Publication
Modified residuei862 – 8621Phosphoserine1 Publication

Post-translational modificationi

Proteolytically cleaved into 2 subunits, an extracellular subunit and a seven-transmembrane subunit By similarity.

Keywords - PTMi

Glycoprotein, Phosphoprotein

Proteomic databases

MaxQBiQ8JZZ7.
PaxDbiQ8JZZ7.
PRIDEiQ8JZZ7.

PTM databases

PhosphoSiteiQ8JZZ7.

Expressioni

Gene expression databases

CleanExiMM_LPHN2.
GenevestigatoriQ8JZZ7.

Interactioni

Subunit structurei

Forms a heterodimer, consisting of a large extracellular region (p120) non-covalently linked to a seven-transmembrane moiety (p85) By similarity.

Structurei

3D structure databases

ProteinModelPortaliQ8JZZ7.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini260 – 31152GPSAdd
BLAST

Sequence similaritiesi

Contains 1 GPS domain.

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG253931.
HOGENOMiHOG000049065.
HOVERGENiHBG052337.
PhylomeDBiQ8JZZ7.

Family and domain databases

InterProiIPR022624. DUF3497.
IPR017981. GPCR_2-like.
IPR003924. GPCR_2_latrophilin.
IPR003334. GPCR_2_latrophilin_rcpt_C.
IPR000832. GPCR_2_secretin-like.
IPR017983. GPCR_2_secretin-like_CS.
IPR000203. GPS.
[Graphical view]
PfamiPF00002. 7tm_2. 1 hit.
PF12003. DUF3497. 1 hit.
PF01825. GPS. 1 hit.
PF02354. Latrophilin. 2 hits.
[Graphical view]
PRINTSiPR00249. GPCRSECRETIN.
PR01444. LATROPHILIN.
SMARTiSM00303. GPS. 1 hit.
[Graphical view]
PROSITEiPS00650. G_PROTEIN_RECEP_F2_2. 1 hit.
PS50261. G_PROTEIN_RECEP_F2_4. 1 hit.
PS50221. GPS. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Fragment.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q8JZZ7-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

PKGPDLSNCT SHWVNQLAQK IRSGENAASL ANELAKHTKG HVFAGDVSSS    50
VRLMEQLVDI LDAQLQELKP SEKDSAGRSY NKAIVDTVDN LLRAEALESW 100
KHMNSSEQAH TATMLLDTLE EGAFVLADNL LEPTRVSMPT ENIVLEVAVL 150
STEGQVQDFK FPLGLKGLGS SIQLSANTVK QNSRNGLAKL VFIIYRSLGQ 200
FLSTENATIK LGADLMGRNS TIAVNSPVIS VSINKESSRV YLTDPVLFTL 250
PHIDPDNYFN ANCSFWNYSE RTMMGYWSTQ GCKLVDTNKT RTTCACSHLT 300
NFAILMAHRE IAYKDGVHHL LLTVITWVGI VVSLVCLAIC IFTFCFFRGL 350
QSDRNTIHKN LCINLFIAEF IFLIGIDKTK YTIACPVFAG LLHFFFLAAF 400
SWMCLEGVQL YLMLVEVFES EYSRKKYYYV AGYLFPATVV GVSAAIDYKS 450
YGTVQACWLH VDNYFIWSFI GPVTFIILLN IIFLVITLCK MVKHSNTLKP 500
DSSRLENIKS WVLGAFALLC LLGLTWSFGL LFVNEETVVM AYLFTAFNAF 550
QGLFIFIFHC ALQKKVRKEY GKCFRHWYCC GGLPTESPHS SVKASTTRTS 600
ARYSSGTQSR IRRMWNDTVR KQSESSFISG DINSTSTLNQ GHSLNNARDT 650
SAMDTLPLNG NFNNSYSLRK ADYHDGVQVV DCGLSLNDTA FEKMIISELV 700
HNNLRGGNKT HNLELKLPVK PVIGGSSSED DAIVADASSL MHGDNPGLEF 750
RHKELEAPLI PQRTHSLLYQ PQKKVKPEAT DSYVSQLTAE ADDHLQSPNR 800
DSLYTSMPNL RDSPYPESSP DMAEDLSPSR RSENEDIYYK SMPNLGAGRH 850
LHMCYQISRG NSDGYIIPIN KEGCIPEGDV REGQMQLVTS L 891
Length:891
Mass (Da):99,452
Last modified:April 26, 2004 - v2
Checksum:iC5008C6438F95389
GO
Isoform 2 (identifier: Q8JZZ7-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     509-509: K → NNYRVCDGYYNTDLPG
     641-641: G → GMTGNYLLTNPLLRPHGTNNPYNTLLAETVVCNAPSAPAFNSPATYRETR

Show »
Length:955
Mass (Da):106,514
Checksum:i68CBF4F016ACEF40
GO

Sequence cautioni

The sequence AAH34660.1 differs from that shown. Reason: Erroneous initiation.

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei509 – 5091K → NNYRVCDGYYNTDLPG in isoform 2. VSP_010110
Alternative sequencei641 – 6411G → GMTGNYLLTNPLLRPHGTNN PYNTLLAETVVCNAPSAPAF NSPATYRETR in isoform 2. VSP_010111

Non-terminal residue

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Non-terminal residuei1 – 11

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AK129215 mRNA. Translation: BAC98025.1.
AK034430 mRNA. Translation: BAC28707.1.
BC034660 mRNA. Translation: AAH34660.1. Different initiation.
UniGeneiMm.331434.
Mm.462301.
Mm.9776.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AK129215 mRNA. Translation: BAC98025.1 .
AK034430 mRNA. Translation: BAC28707.1 .
BC034660 mRNA. Translation: AAH34660.1 . Different initiation.
UniGenei Mm.331434.
Mm.462301.
Mm.9776.

3D structure databases

ProteinModelPortali Q8JZZ7.
ModBasei Search...
MobiDBi Search...

Protein family/group databases

MEROPSi S63.012.
GPCRDBi Search...

PTM databases

PhosphoSitei Q8JZZ7.

Proteomic databases

MaxQBi Q8JZZ7.
PaxDbi Q8JZZ7.
PRIDEi Q8JZZ7.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Organism-specific databases

MGIi MGI:2139714. Lphn2.
Rougei Search...

Phylogenomic databases

eggNOGi NOG253931.
HOGENOMi HOG000049065.
HOVERGENi HBG052337.
PhylomeDBi Q8JZZ7.

Miscellaneous databases

ChiTaRSi LPHN2. mouse.
PROi Q8JZZ7.
SOURCEi Search...

Gene expression databases

CleanExi MM_LPHN2.
Genevestigatori Q8JZZ7.

Family and domain databases

InterProi IPR022624. DUF3497.
IPR017981. GPCR_2-like.
IPR003924. GPCR_2_latrophilin.
IPR003334. GPCR_2_latrophilin_rcpt_C.
IPR000832. GPCR_2_secretin-like.
IPR017983. GPCR_2_secretin-like_CS.
IPR000203. GPS.
[Graphical view ]
Pfami PF00002. 7tm_2. 1 hit.
PF12003. DUF3497. 1 hit.
PF01825. GPS. 1 hit.
PF02354. Latrophilin. 2 hits.
[Graphical view ]
PRINTSi PR00249. GPCRSECRETIN.
PR01444. LATROPHILIN.
SMARTi SM00303. GPS. 1 hit.
[Graphical view ]
PROSITEi PS00650. G_PROTEIN_RECEP_F2_2. 1 hit.
PS50261. G_PROTEIN_RECEP_F2_4. 1 hit.
PS50221. GPS. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Prediction of the coding sequences of mouse homologues of KIAA gene: III. The complete nucleotide sequences of 500 mouse KIAA-homologous cDNAs identified by screening of terminal sequences of cDNA clones randomly sampled from size-fractionated libraries."
    Okazaki N., Kikuno R., Ohara R., Inamoto S., Koseki H., Hiraoka S., Saga Y., Nagase T., Ohara O., Koga H.
    DNA Res. 10:167-180(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Embryonic tail.
  2. Lubec G., Kang S.U.
    Submitted (APR-2007) to UniProtKB
    Cited for: PROTEIN SEQUENCE OF 211-218, IDENTIFICATION BY MASS SPECTROMETRY.
    Strain: C57BL/6.
    Tissue: Brain.
  3. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 486-891 (ISOFORM 2).
    Strain: C57BL/6J.
    Tissue: Diencephalon.
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 660-891.
    Tissue: Retina.
  5. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-806 AND SER-862, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Liver.
  6. "The mouse C2C12 myoblast cell surface N-linked glycoproteome: identification, glycosite occupancy, and membrane orientation."
    Gundry R.L., Raginski K., Tarasova Y., Tchernyshyov I., Bausch-Fluck D., Elliott S.T., Boheler K.R., Van Eyk J.E., Wollscheid B.
    Mol. Cell. Proteomics 8:2555-2569(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-206.
    Tissue: Myoblast.
  7. "Mass-spectrometric identification and relative quantification of N-linked cell surface glycoproteins."
    Wollscheid B., Bausch-Fluck D., Henderson C., O'Brien R., Bibel M., Schiess R., Aebersold R., Watts J.D.
    Nat. Biotechnol. 27:378-386(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-206.

Entry informationi

Entry nameiLPHN2_MOUSE
AccessioniPrimary (citable) accession number: Q8JZZ7
Secondary accession number(s): Q8BM90
Entry historyi
Integrated into UniProtKB/Swiss-Prot: April 26, 2004
Last sequence update: April 26, 2004
Last modified: May 14, 2014
This is version 92 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. 7-transmembrane G-linked receptors
    List of 7-transmembrane G-linked receptor entries
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi