Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Adhesion G protein-coupled receptor L2

Gene

Adgrl2

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Calcium-independent receptor of low affinity for alpha-latrotoxin, an excitatory neurotoxin present in black widow spider venom which triggers massive exocytosis from neurons and neuroendocrine cells. Receptor propably implicated in the regulation of exocytosis.By similarity

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sitei828 – 8292CleavageBy similarity

GO - Molecular functioni

GO - Biological processi

  • positive regulation of synapse assembly Source: MGI
Complete GO annotation...

Keywords - Molecular functioni

G-protein coupled receptor, Receptor, Transducer

Protein family/group databases

MEROPSiS63.012.

Names & Taxonomyi

Protein namesi
Recommended name:
Adhesion G protein-coupled receptor L2
Alternative name(s):
Calcium-independent alpha-latrotoxin receptor 2
Short name:
CIRL-2
Latrophilin-2
Gene namesi
Name:Adgrl2
Synonyms:Kiaa0786, Lphn2
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
ProteomesiUP000000589 Componenti: Unplaced

Organism-specific databases

MGIiMGI:2139714. Adgrl2.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini26 – 855830ExtracellularCuratedAdd
BLAST
Transmembranei856 – 87621Helical; Name=1Sequence AnalysisAdd
BLAST
Topological domaini877 – 8848CytoplasmicCurated
Transmembranei885 – 90521Helical; Name=2Sequence AnalysisAdd
BLAST
Topological domaini906 – 9116ExtracellularCurated
Transmembranei912 – 93221Helical; Name=3Sequence AnalysisAdd
BLAST
Topological domaini933 – 95523CytoplasmicCuratedAdd
BLAST
Transmembranei956 – 97621Helical; Name=4Sequence AnalysisAdd
BLAST
Topological domaini977 – 99418ExtracellularCuratedAdd
BLAST
Transmembranei995 – 101521Helical; Name=5Sequence AnalysisAdd
BLAST
Topological domaini1016 – 106449CytoplasmicCuratedAdd
BLAST
Transmembranei1065 – 108521Helical; Name=6Sequence AnalysisAdd
BLAST
Topological domaini1086 – 10905ExtracellularCurated
Transmembranei1091 – 111121Helical; Name=7Sequence AnalysisAdd
BLAST

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 2525Sequence AnalysisAdd
BLAST
Chaini26 – 14871462Adhesion G protein-coupled receptor L2PRO_0000070343Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi99 – 991N-linked (GlcNAc...)Sequence Analysis
Glycosylationi524 – 5241N-linked (GlcNAc...)Sequence Analysis
Glycosylationi735 – 7351N-linked (GlcNAc...)2 Publications
Modified residuei1402 – 14021Phosphoserine1 Publication
Modified residuei1458 – 14581Phosphoserine1 Publication

Post-translational modificationi

Proteolytically cleaved into 2 subunits, an extracellular subunit and a seven-transmembrane subunit.By similarity

Keywords - PTMi

Glycoprotein, Phosphoprotein

Proteomic databases

MaxQBiQ8JZZ7.
PaxDbiQ8JZZ7.
PRIDEiQ8JZZ7.

PTM databases

PhosphoSiteiQ8JZZ7.

Expressioni

Tissue specificityi

Ubiquitously expressed.1 Publication

Developmental stagei

Decrease in mRNA levels during postnatal development.1 Publication

Gene expression databases

CleanExiMM_LPHN2.

Interactioni

Subunit structurei

Forms a heterodimer, consisting of a large extracellular region non-covalently linked to a seven-transmembrane moiety.By similarity

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000101734.

Structurei

3D structure databases

ProteinModelPortaliQ8JZZ7.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini41 – 13090SUEL-type lectinPROSITE-ProRule annotationAdd
BLAST
Domaini139 – 398260Olfactomedin-likePROSITE-ProRule annotationAdd
BLAST
Domaini789 – 84052GPSPROSITE-ProRule annotationAdd
BLAST

Sequence similaritiesi

Contains 1 GPS domain.PROSITE-ProRule annotation
Contains 1 olfactomedin-like domain.PROSITE-ProRule annotation
Contains 1 SUEL-type lectin domain.PROSITE-ProRule annotation

Keywords - Domaini

Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG253931.
GeneTreeiENSGT00760000118787.
HOGENOMiHOG000049065.
HOVERGENiHBG052337.
InParanoidiQ8JZZ7.
OMAiYFNANCS.
OrthoDBiEOG76DTRK.
PhylomeDBiQ8JZZ7.
TreeFamiTF351999.

Family and domain databases

InterProiIPR022624. DUF3497.
IPR017981. GPCR_2-like.
IPR001879. GPCR_2_extracellular_dom.
IPR003924. GPCR_2_latrophilin.
IPR003334. GPCR_2_latrophilin_rcpt_C.
IPR000832. GPCR_2_secretin-like.
IPR017983. GPCR_2_secretin-like_CS.
IPR000203. GPS.
IPR031240. Latrophilin-2.
IPR000922. Lectin_gal-bd_dom.
IPR003112. Olfac-like.
[Graphical view]
PANTHERiPTHR12011:SF61. PTHR12011:SF61. 1 hit.
PfamiPF00002. 7tm_2. 1 hit.
PF12003. DUF3497. 1 hit.
PF02140. Gal_Lectin. 1 hit.
PF01825. GPS. 1 hit.
PF02793. HRM. 1 hit.
PF02354. Latrophilin. 1 hit.
PF02191. OLF. 1 hit.
[Graphical view]
PRINTSiPR00249. GPCRSECRETIN.
PR01444. LATROPHILIN.
SMARTiSM00303. GPS. 1 hit.
SM00008. HormR. 1 hit.
SM00284. OLF. 1 hit.
[Graphical view]
PROSITEiPS00650. G_PROTEIN_RECEP_F2_2. 1 hit.
PS50227. G_PROTEIN_RECEP_F2_3. 1 hit.
PS50261. G_PROTEIN_RECEP_F2_4. 1 hit.
PS50221. GPS. 1 hit.
PS51132. OLF. 1 hit.
PS50228. SUEL_LECTIN. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8JZZ7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MVSSGCRMRS LWFIIIISFS PSTEGFSRAA LPFGLVRREL SCEGYSIDLR
60 70 80 90 100
CPGSDVIMIE SANYGRTDDK ICDADPFQME NTDCYLPDAF KIMTQRCNNR
110 120 130 140 150
TQCIVVTGSD VFPDPCPGTY KYLEVQYECV PYSKMLVFVC PGTLKAIVDS
160 170 180 190 200
PCIYEAEQKS GAWCKDPLQA ADKIYFMPWT PYRTDTLIEY ASLEDFQNSR
210 220 230 240 250
QTTTYKLPNR VDGTGFVVYD GAVFFNKERT RNIVKFDLRT RIKSGEAIIN
260 270 280 290 300
YANYHDTSPY RWGGKTDIDL AVDENGLWVI YATEQNNGMI VISQLNPYTL
310 320 330 340 350
RFEATWETAY DKRAASNAFM ICGVLYVVRS VYQDNESEAG KNTIDYIYNT
360 370 380 390 400
RLSRGEYVDV PFPNQYQYIA AVDYNPRDNQ LYVWNNNFIL RYSLEFGPPD
410 420 430 440 450
PAQVPTTAVT ITSSAELFKT TISTTSSASQ RGPVSSTAAG PQDGSRGTKP
460 470 480 490 500
PPAVSTTKIP PVTNIFPLPE RFCEALDWKG IKWPQTQRGM MVERPCPKGT
510 520 530 540 550
RGTASYLCMA STGTWNPKGP DLSNCTSHWV NQLAQKIRSG ENAASLANEL
560 570 580 590 600
AKHTKGHVFA GDVSSSVRLM EQLVDILDAQ LQELKPSEKD SAGRSYNKLQ
610 620 630 640 650
KREKTCRAYL KAIVDTVDNL LRAEALESWK HMNSSEQAHT ATMLLDTLEE
660 670 680 690 700
GAFVLADNLL EPTRVSMPTE NIVLEVAVLS TEGQVQDFKF PLGLKGLGSS
710 720 730 740 750
IQLSANTVKQ NSRNGLAKLV FIIYRSLGQF LSTENATIKL GADLMGRNST
760 770 780 790 800
IAVNSPVISV SINKESSRVY LTDPVLFTLP HIDPDNYFNA NCSFWNYSER
810 820 830 840 850
TMMGYWSTQG CKLVDTNKTR TTCACSHLTN FAILMAHREI AYKDGVHHLL
860 870 880 890 900
LTVITWVGIV VSLVCLAICI FTFCFFRGLQ SDRNTIHKNL CINLFIAEFI
910 920 930 940 950
FLIGIDKTKY TIACPVFAGL LHFFFLAAFS WMCLEGVQLY LMLVEVFESE
960 970 980 990 1000
YSRKKYYYVA GYLFPATVVG VSAAIDYKSY GTVQACWLHV DNYFIWSFIG
1010 1020 1030 1040 1050
PVTFIILLNI IFLVITLCKM VKHSNTLKPD SSRLENINNY RVCDGYYNTD
1060 1070 1080 1090 1100
LPGYEDNKPF IKSWVLGAFA LLCLLGLTWS FGLLFVNEET VVMAYLFTAF
1110 1120 1130 1140 1150
NAFQGLFIFI FHCALQKKVR KEYGKCFRHW YCCGGLPTES PHSSVKASTT
1160 1170 1180 1190 1200
RTSARYSSGT QSRIRRMWND TVRKQSESSF ISGDINSTST LNQGMTGNYL
1210 1220 1230 1240 1250
LTNPLLRPHG TNNPYNTLLA ETVVCNAPSA PAFNSPGHSL NNARDTSAMD
1260 1270 1280 1290 1300
TLPLNGNFNN SYSLRKADYH DGVQVVDCGL SLNDTAFEKM IISELVHNNL
1310 1320 1330 1340 1350
RGGNKTHNLE LKLPVKPVIG GSSSEDDAIV ADASSLMHGD NPGLEFRHKE
1360 1370 1380 1390 1400
LEAPLIPQRT HSLLYQPQKK VKPEATDSYV SQLTAEADDH LQSPNRDSLY
1410 1420 1430 1440 1450
TSMPNLRDSP YPESSPDMAE DLSPSRRSEN EDIYYKSMPN LGAGRHLHMC
1460 1470 1480
YQISRGNSDG YIIPINKEGC IPEGDVREGQ MQLVTSL
Length:1,487
Mass (Da):166,577
Last modified:June 24, 2015 - v3
Checksum:iA56F7A5409E801F8
GO
Isoform 2 (identifier: Q8JZZ7-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1062-1062: K → NNYRVCDGYYNTDLPG
     1194-1194: G → GMTGNYLLTNPLLRPHGTNNPYNTLLAETVVCNAPSAPAFNSPATYRETR

Show »
Length:1,551
Mass (Da):173,640
Checksum:iE74F891832FBABBC
GO

Sequence cautioni

The sequence AAH34660.1 differs from that shown. Reason: Erroneous initiation. Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1062 – 10621K → NNYRVCDGYYNTDLPG in isoform 2. 1 PublicationVSP_010110
Alternative sequencei1194 – 11941G → GMTGNYLLTNPLLRPHGTNN PYNTLLAETVVCNAPSAPAF NSPATYRETR in isoform 2. 1 PublicationVSP_010111

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AC113315 Genomic DNA. No translation available.
AC114679 Genomic DNA. No translation available.
AC138591 Genomic DNA. No translation available.
AK129215 mRNA. Translation: BAC98025.1.
AK034430 mRNA. Translation: BAC28707.1.
BC034660 mRNA. Translation: AAH34660.1. Different initiation.
UniGeneiMm.331434.
Mm.462301.
Mm.9776.

Genome annotation databases

EnsembliENSMUST00000106128; ENSMUSP00000101734; ENSMUSG00000028184. [Q8JZZ7-1]
UCSCiuc008rsa.1. mouse. [Q8JZZ7-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AC113315 Genomic DNA. No translation available.
AC114679 Genomic DNA. No translation available.
AC138591 Genomic DNA. No translation available.
AK129215 mRNA. Translation: BAC98025.1.
AK034430 mRNA. Translation: BAC28707.1.
BC034660 mRNA. Translation: AAH34660.1. Different initiation.
UniGeneiMm.331434.
Mm.462301.
Mm.9776.

3D structure databases

ProteinModelPortaliQ8JZZ7.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000101734.

Protein family/group databases

MEROPSiS63.012.
GPCRDBiSearch...

PTM databases

PhosphoSiteiQ8JZZ7.

Proteomic databases

MaxQBiQ8JZZ7.
PaxDbiQ8JZZ7.
PRIDEiQ8JZZ7.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000106128; ENSMUSP00000101734; ENSMUSG00000028184. [Q8JZZ7-1]
UCSCiuc008rsa.1. mouse. [Q8JZZ7-1]

Organism-specific databases

MGIiMGI:2139714. Adgrl2.
RougeiSearch...

Phylogenomic databases

eggNOGiNOG253931.
GeneTreeiENSGT00760000118787.
HOGENOMiHOG000049065.
HOVERGENiHBG052337.
InParanoidiQ8JZZ7.
OMAiYFNANCS.
OrthoDBiEOG76DTRK.
PhylomeDBiQ8JZZ7.
TreeFamiTF351999.

Miscellaneous databases

ChiTaRSiLphn2. mouse.
NextBioi35555343.
PROiQ8JZZ7.
SOURCEiSearch...

Gene expression databases

CleanExiMM_LPHN2.

Family and domain databases

InterProiIPR022624. DUF3497.
IPR017981. GPCR_2-like.
IPR001879. GPCR_2_extracellular_dom.
IPR003924. GPCR_2_latrophilin.
IPR003334. GPCR_2_latrophilin_rcpt_C.
IPR000832. GPCR_2_secretin-like.
IPR017983. GPCR_2_secretin-like_CS.
IPR000203. GPS.
IPR031240. Latrophilin-2.
IPR000922. Lectin_gal-bd_dom.
IPR003112. Olfac-like.
[Graphical view]
PANTHERiPTHR12011:SF61. PTHR12011:SF61. 1 hit.
PfamiPF00002. 7tm_2. 1 hit.
PF12003. DUF3497. 1 hit.
PF02140. Gal_Lectin. 1 hit.
PF01825. GPS. 1 hit.
PF02793. HRM. 1 hit.
PF02354. Latrophilin. 1 hit.
PF02191. OLF. 1 hit.
[Graphical view]
PRINTSiPR00249. GPCRSECRETIN.
PR01444. LATROPHILIN.
SMARTiSM00303. GPS. 1 hit.
SM00008. HormR. 1 hit.
SM00284. OLF. 1 hit.
[Graphical view]
PROSITEiPS00650. G_PROTEIN_RECEP_F2_2. 1 hit.
PS50227. G_PROTEIN_RECEP_F2_3. 1 hit.
PS50261. G_PROTEIN_RECEP_F2_4. 1 hit.
PS50221. GPS. 1 hit.
PS51132. OLF. 1 hit.
PS50228. SUEL_LECTIN. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    Strain: C57BL/6J.
  2. "Prediction of the coding sequences of mouse homologues of KIAA gene: III. The complete nucleotide sequences of 500 mouse KIAA-homologous cDNAs identified by screening of terminal sequences of cDNA clones randomly sampled from size-fractionated libraries."
    Okazaki N., Kikuno R., Ohara R., Inamoto S., Koseki H., Hiraoka S., Saga Y., Nagase T., Ohara O., Koga H.
    DNA Res. 10:167-180(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 517-1487 (ISOFORM 1).
    Tissue: Embryonic tail.
  3. Lubec G., Kang S.U.
    Submitted (APR-2007) to UniProtKB
    Cited for: PROTEIN SEQUENCE OF 740-747, IDENTIFICATION BY MASS SPECTROMETRY.
    Strain: C57BL/6.
    Tissue: Brain.
  4. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1015-1487 (ISOFORM 2).
    Strain: C57BL/6J.
    Tissue: Diencephalon.
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1256-1487.
    Tissue: Retina.
  6. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1402 AND SER-1458, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Liver.
  7. "The mouse C2C12 myoblast cell surface N-linked glycoproteome: identification, glycosite occupancy, and membrane orientation."
    Gundry R.L., Raginski K., Tarasova Y., Tchernyshyov I., Bausch-Fluck D., Elliott S.T., Boheler K.R., Van Eyk J.E., Wollscheid B.
    Mol. Cell. Proteomics 8:2555-2569(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-735.
    Tissue: Myoblast.
  8. "Mass-spectrometric identification and relative quantification of N-linked cell surface glycoproteins."
    Wollscheid B., Bausch-Fluck D., Henderson C., O'Brien R., Bibel M., Schiess R., Aebersold R., Watts J.D.
    Nat. Biotechnol. 27:378-386(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-735.
  9. "Latrophilins function as heterophilic cell-adhesion molecules by binding to teneurins: regulation by alternative splicing."
    Boucard A.A., Maxeiner S., Suedhof T.C.
    J. Biol. Chem. 289:387-402(2014) [PubMed] [Europe PMC] [Abstract]
    Cited for: TISSUE SPECIFICITY, DEVELOPMENTAL STAGE, FUNCTION.

Entry informationi

Entry nameiAGRL2_MOUSE
AccessioniPrimary (citable) accession number: Q8JZZ7
Secondary accession number(s): E9Q6C7, Q8BM90
Entry historyi
Integrated into UniProtKB/Swiss-Prot: April 26, 2004
Last sequence update: June 24, 2015
Last modified: July 22, 2015
This is version 100 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. 7-transmembrane G-linked receptors
    List of 7-transmembrane G-linked receptor entries
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.