Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q8JZZ7 (LPHN2_MOUSE) Reviewed, UniProtKB/Swiss-Prot

Last modified March 19, 2014. Version 90. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (3) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Latrophilin-2
Alternative name(s):
Calcium-independent alpha-latrotoxin receptor 2
Short name=CIRL-2
Gene names
Name:Lphn2
Synonyms:Kiaa0786
OrganismMus musculus (Mouse) [Reference proteome]
Taxonomic identifier10090 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus

Protein attributes

Sequence length891 AA.
Sequence statusFragment.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Calcium-independent receptor of low affinity for alpha-latrotoxin, an excitatory neurotoxin present in black widow spider venom which triggers massive exocytosis from neurons and neuroendocrine cells. Receptor propably implicated in the regulation of exocytosis By similarity.

Subunit structure

Forms a heterodimer, consisting of a large extracellular region (p120) non-covalently linked to a seven-transmembrane moiety (p85) By similarity.

Subcellular location

Cell membrane; Multi-pass membrane protein.

Post-translational modification

Proteolytically cleaved into 2 subunits, an extracellular subunit and a seven-transmembrane subunit By similarity.

Sequence similarities

Belongs to the G-protein coupled receptor 2 family. LN-TM7 subfamily.

Contains 1 GPS domain.

Sequence caution

The sequence AAH34660.1 differs from that shown. Reason: Erroneous initiation.

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q8JZZ7-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q8JZZ7-2)

The sequence of this isoform differs from the canonical sequence as follows:
     509-509: K → NNYRVCDGYYNTDLPG
     641-641: G → GMTGNYLLTNPLLRPHGTNNPYNTLLAETVVCNAPSAPAFNSPATYRETR

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain‹1 – 891›891Latrophilin-2
PRO_0000070343

Regions

Topological domain‹1 – 326›326Extracellular Potential
Transmembrane327 – 34721Helical; Name=1; Potential
Topological domain348 – 3558Cytoplasmic Potential
Transmembrane356 – 37621Helical; Name=2; Potential
Topological domain377 – 3826Extracellular Potential
Transmembrane383 – 40321Helical; Name=3; Potential
Topological domain404 – 42623Cytoplasmic Potential
Transmembrane427 – 44721Helical; Name=4; Potential
Topological domain448 – 46518Extracellular Potential
Transmembrane466 – 48621Helical; Name=5; Potential
Topological domain487 – 51226Cytoplasmic Potential
Transmembrane513 – 53321Helical; Name=6; Potential
Topological domain534 – 5374Extracellular Potential
Transmembrane538 – 55821Helical; Name=7; Potential
Topological domain559 – 891333Cytoplasmic Potential
Domain260 – 31152GPS

Sites

Site299 – 3002Cleavage By similarity

Amino acid modifications

Modified residue8061Phosphoserine Ref.5
Modified residue8621Phosphoserine Ref.5
Glycosylation81N-linked (GlcNAc...) Potential
Glycosylation1041N-linked (GlcNAc...) Potential
Glycosylation2061N-linked (GlcNAc...) Ref.6 Ref.7
Glycosylation2191N-linked (GlcNAc...) Potential
Glycosylation2621N-linked (GlcNAc...) Potential
Glycosylation2671N-linked (GlcNAc...) Potential
Glycosylation2881N-linked (GlcNAc...) Potential

Natural variations

Alternative sequence5091K → NNYRVCDGYYNTDLPG in isoform 2.
VSP_010110
Alternative sequence6411G → GMTGNYLLTNPLLRPHGTNN PYNTLLAETVVCNAPSAPAF NSPATYRETR in isoform 2.
VSP_010111

Experimental info

Non-terminal residue11

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified April 26, 2004. Version 2.
Checksum: C5008C6438F95389

FASTA89199,452
        10         20         30         40         50         60 
PKGPDLSNCT SHWVNQLAQK IRSGENAASL ANELAKHTKG HVFAGDVSSS VRLMEQLVDI 

        70         80         90        100        110        120 
LDAQLQELKP SEKDSAGRSY NKAIVDTVDN LLRAEALESW KHMNSSEQAH TATMLLDTLE 

       130        140        150        160        170        180 
EGAFVLADNL LEPTRVSMPT ENIVLEVAVL STEGQVQDFK FPLGLKGLGS SIQLSANTVK 

       190        200        210        220        230        240 
QNSRNGLAKL VFIIYRSLGQ FLSTENATIK LGADLMGRNS TIAVNSPVIS VSINKESSRV 

       250        260        270        280        290        300 
YLTDPVLFTL PHIDPDNYFN ANCSFWNYSE RTMMGYWSTQ GCKLVDTNKT RTTCACSHLT 

       310        320        330        340        350        360 
NFAILMAHRE IAYKDGVHHL LLTVITWVGI VVSLVCLAIC IFTFCFFRGL QSDRNTIHKN 

       370        380        390        400        410        420 
LCINLFIAEF IFLIGIDKTK YTIACPVFAG LLHFFFLAAF SWMCLEGVQL YLMLVEVFES 

       430        440        450        460        470        480 
EYSRKKYYYV AGYLFPATVV GVSAAIDYKS YGTVQACWLH VDNYFIWSFI GPVTFIILLN 

       490        500        510        520        530        540 
IIFLVITLCK MVKHSNTLKP DSSRLENIKS WVLGAFALLC LLGLTWSFGL LFVNEETVVM 

       550        560        570        580        590        600 
AYLFTAFNAF QGLFIFIFHC ALQKKVRKEY GKCFRHWYCC GGLPTESPHS SVKASTTRTS 

       610        620        630        640        650        660 
ARYSSGTQSR IRRMWNDTVR KQSESSFISG DINSTSTLNQ GHSLNNARDT SAMDTLPLNG 

       670        680        690        700        710        720 
NFNNSYSLRK ADYHDGVQVV DCGLSLNDTA FEKMIISELV HNNLRGGNKT HNLELKLPVK 

       730        740        750        760        770        780 
PVIGGSSSED DAIVADASSL MHGDNPGLEF RHKELEAPLI PQRTHSLLYQ PQKKVKPEAT 

       790        800        810        820        830        840 
DSYVSQLTAE ADDHLQSPNR DSLYTSMPNL RDSPYPESSP DMAEDLSPSR RSENEDIYYK 

       850        860        870        880        890 
SMPNLGAGRH LHMCYQISRG NSDGYIIPIN KEGCIPEGDV REGQMQLVTS L 

« Hide

Isoform 2 [UniParc].

Checksum: 68CBF4F016ACEF40
Show »

FASTA955106,514

References

« Hide 'large scale' references
[1]"Prediction of the coding sequences of mouse homologues of KIAA gene: III. The complete nucleotide sequences of 500 mouse KIAA-homologous cDNAs identified by screening of terminal sequences of cDNA clones randomly sampled from size-fractionated libraries."
Okazaki N., Kikuno R., Ohara R., Inamoto S., Koseki H., Hiraoka S., Saga Y., Nagase T., Ohara O., Koga H.
DNA Res. 10:167-180(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Embryonic tail.
[2]Lubec G., Kang S.U.
Submitted (APR-2007) to UniProtKB
Cited for: PROTEIN SEQUENCE OF 211-218, MASS SPECTROMETRY.
Strain: C57BL/6.
Tissue: Brain.
[3]"The transcriptional landscape of the mammalian genome."
Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. expand/collapse author list , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 486-891 (ISOFORM 2).
Strain: C57BL/6J.
Tissue: Diencephalon.
[4]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 660-891.
Tissue: Retina.
[5]"Large-scale phosphorylation analysis of mouse liver."
Villen J., Beausoleil S.A., Gerber S.A., Gygi S.P.
Proc. Natl. Acad. Sci. U.S.A. 104:1488-1493(2007) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-806 AND SER-862, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Liver.
[6]"The mouse C2C12 myoblast cell surface N-linked glycoproteome: identification, glycosite occupancy, and membrane orientation."
Gundry R.L., Raginski K., Tarasova Y., Tchernyshyov I., Bausch-Fluck D., Elliott S.T., Boheler K.R., Van Eyk J.E., Wollscheid B.
Mol. Cell. Proteomics 8:2555-2569(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-206.
Tissue: Myoblast.
[7]"Mass-spectrometric identification and relative quantification of N-linked cell surface glycoproteins."
Wollscheid B., Bausch-Fluck D., Henderson C., O'Brien R., Bibel M., Schiess R., Aebersold R., Watts J.D.
Nat. Biotechnol. 27:378-386(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-206.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AK129215 mRNA. Translation: BAC98025.1.
AK034430 mRNA. Translation: BAC28707.1.
BC034660 mRNA. Translation: AAH34660.1. Different initiation.
UniGeneMm.331434.
Mm.462301.
Mm.9776.

3D structure databases

ProteinModelPortalQ8JZZ7.
ModBaseSearch...
MobiDBSearch...

Protein family/group databases

MEROPSS63.012.
GPCRDBSearch...

PTM databases

PhosphoSiteQ8JZZ7.

Proteomic databases

PaxDbQ8JZZ7.
PRIDEQ8JZZ7.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Organism-specific databases

MGIMGI:2139714. Lphn2.
RougeSearch...

Phylogenomic databases

eggNOGNOG253931.
HOGENOMHOG000049065.
HOVERGENHBG052337.

Gene expression databases

CleanExMM_LPHN2.
GenevestigatorQ8JZZ7.

Family and domain databases

InterProIPR022624. DUF3497.
IPR017981. GPCR_2-like.
IPR003924. GPCR_2_latrophilin.
IPR003334. GPCR_2_latrophilin_rcpt_C.
IPR000832. GPCR_2_secretin-like.
IPR017983. GPCR_2_secretin-like_CS.
IPR000203. GPS.
[Graphical view]
PfamPF00002. 7tm_2. 1 hit.
PF12003. DUF3497. 1 hit.
PF01825. GPS. 1 hit.
PF02354. Latrophilin. 2 hits.
[Graphical view]
PRINTSPR00249. GPCRSECRETIN.
PR01444. LATROPHILIN.
SMARTSM00303. GPS. 1 hit.
[Graphical view]
PROSITEPS00650. G_PROTEIN_RECEP_F2_2. 1 hit.
PS50261. G_PROTEIN_RECEP_F2_4. 1 hit.
PS50221. GPS. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

ChiTaRSLPHN2. mouse.
PROQ8JZZ7.
SOURCESearch...

Entry information

Entry nameLPHN2_MOUSE
AccessionPrimary (citable) accession number: Q8JZZ7
Secondary accession number(s): Q8BM90
Entry history
Integrated into UniProtKB/Swiss-Prot: April 26, 2004
Last sequence update: April 26, 2004
Last modified: March 19, 2014
This is version 90 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Relevant documents

SIMILARITY comments

Index of protein domains and families

MGD cross-references

Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot

7-transmembrane G-linked receptors

List of 7-transmembrane G-linked receptor entries