Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q8JZZ7

- LPHN2_MOUSE

UniProt

Q8JZZ7 - LPHN2_MOUSE

Protein

Latrophilin-2

Gene

Lphn2

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 4 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 93 (01 Oct 2014)
      Sequence version 2 (26 Apr 2004)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Calcium-independent receptor of low affinity for alpha-latrotoxin, an excitatory neurotoxin present in black widow spider venom which triggers massive exocytosis from neurons and neuroendocrine cells. Receptor propably implicated in the regulation of exocytosis By similarity.By similarity

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sitei299 – 3002CleavageBy similarity

    GO - Molecular functioni

    1. G-protein coupled receptor activity Source: UniProtKB-KW

    GO - Biological processi

    1. neuropeptide signaling pathway Source: InterPro

    Keywords - Molecular functioni

    G-protein coupled receptor, Receptor, Transducer

    Protein family/group databases

    MEROPSiS63.012.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Latrophilin-2
    Alternative name(s):
    Calcium-independent alpha-latrotoxin receptor 2
    Short name:
    CIRL-2
    Gene namesi
    Name:Lphn2
    Synonyms:Kiaa0786
    OrganismiMus musculus (Mouse)
    Taxonomic identifieri10090 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
    ProteomesiUP000000589: Unplaced

    Organism-specific databases

    MGIiMGI:2139714. Lphn2.

    Subcellular locationi

    GO - Cellular componenti

    1. integral component of membrane Source: UniProtKB-KW
    2. plasma membrane Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Cell membrane, Membrane

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini‹1 – 891›891Latrophilin-2PRO_0000070343Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Glycosylationi8 – 81N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi104 – 1041N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi206 – 2061N-linked (GlcNAc...)2 Publications
    Glycosylationi219 – 2191N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi262 – 2621N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi267 – 2671N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi288 – 2881N-linked (GlcNAc...)Sequence Analysis
    Modified residuei806 – 8061Phosphoserine1 Publication
    Modified residuei862 – 8621Phosphoserine1 Publication

    Post-translational modificationi

    Proteolytically cleaved into 2 subunits, an extracellular subunit and a seven-transmembrane subunit.By similarity

    Keywords - PTMi

    Glycoprotein, Phosphoprotein

    Proteomic databases

    MaxQBiQ8JZZ7.
    PaxDbiQ8JZZ7.
    PRIDEiQ8JZZ7.

    PTM databases

    PhosphoSiteiQ8JZZ7.

    Expressioni

    Gene expression databases

    CleanExiMM_LPHN2.
    GenevestigatoriQ8JZZ7.

    Interactioni

    Subunit structurei

    Forms a heterodimer, consisting of a large extracellular region (p120) non-covalently linked to a seven-transmembrane moiety (p85).By similarity

    Structurei

    3D structure databases

    ProteinModelPortaliQ8JZZ7.
    ModBaseiSearch...
    MobiDBiSearch...

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini‹1 – 326›326ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini348 – 3558CytoplasmicSequence Analysis
    Topological domaini377 – 3826ExtracellularSequence Analysis
    Topological domaini404 – 42623CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini448 – 46518ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini487 – 51226CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini534 – 5374ExtracellularSequence Analysis
    Topological domaini559 – 891333CytoplasmicSequence AnalysisAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei327 – 34721Helical; Name=1Sequence AnalysisAdd
    BLAST
    Transmembranei356 – 37621Helical; Name=2Sequence AnalysisAdd
    BLAST
    Transmembranei383 – 40321Helical; Name=3Sequence AnalysisAdd
    BLAST
    Transmembranei427 – 44721Helical; Name=4Sequence AnalysisAdd
    BLAST
    Transmembranei466 – 48621Helical; Name=5Sequence AnalysisAdd
    BLAST
    Transmembranei513 – 53321Helical; Name=6Sequence AnalysisAdd
    BLAST
    Transmembranei538 – 55821Helical; Name=7Sequence AnalysisAdd
    BLAST

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini260 – 31152GPSPROSITE-ProRule annotationAdd
    BLAST

    Sequence similaritiesi

    Contains 1 GPS domain.PROSITE-ProRule annotation

    Keywords - Domaini

    Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiNOG253931.
    HOGENOMiHOG000049065.
    HOVERGENiHBG052337.
    PhylomeDBiQ8JZZ7.

    Family and domain databases

    InterProiIPR022624. DUF3497.
    IPR017981. GPCR_2-like.
    IPR003924. GPCR_2_latrophilin.
    IPR003334. GPCR_2_latrophilin_rcpt_C.
    IPR000832. GPCR_2_secretin-like.
    IPR017983. GPCR_2_secretin-like_CS.
    IPR000203. GPS.
    [Graphical view]
    PfamiPF00002. 7tm_2. 1 hit.
    PF12003. DUF3497. 1 hit.
    PF01825. GPS. 1 hit.
    PF02354. Latrophilin. 2 hits.
    [Graphical view]
    PRINTSiPR00249. GPCRSECRETIN.
    PR01444. LATROPHILIN.
    SMARTiSM00303. GPS. 1 hit.
    [Graphical view]
    PROSITEiPS00650. G_PROTEIN_RECEP_F2_2. 1 hit.
    PS50261. G_PROTEIN_RECEP_F2_4. 1 hit.
    PS50221. GPS. 1 hit.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Fragment.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q8JZZ7-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    PKGPDLSNCT SHWVNQLAQK IRSGENAASL ANELAKHTKG HVFAGDVSSS    50
    VRLMEQLVDI LDAQLQELKP SEKDSAGRSY NKAIVDTVDN LLRAEALESW 100
    KHMNSSEQAH TATMLLDTLE EGAFVLADNL LEPTRVSMPT ENIVLEVAVL 150
    STEGQVQDFK FPLGLKGLGS SIQLSANTVK QNSRNGLAKL VFIIYRSLGQ 200
    FLSTENATIK LGADLMGRNS TIAVNSPVIS VSINKESSRV YLTDPVLFTL 250
    PHIDPDNYFN ANCSFWNYSE RTMMGYWSTQ GCKLVDTNKT RTTCACSHLT 300
    NFAILMAHRE IAYKDGVHHL LLTVITWVGI VVSLVCLAIC IFTFCFFRGL 350
    QSDRNTIHKN LCINLFIAEF IFLIGIDKTK YTIACPVFAG LLHFFFLAAF 400
    SWMCLEGVQL YLMLVEVFES EYSRKKYYYV AGYLFPATVV GVSAAIDYKS 450
    YGTVQACWLH VDNYFIWSFI GPVTFIILLN IIFLVITLCK MVKHSNTLKP 500
    DSSRLENIKS WVLGAFALLC LLGLTWSFGL LFVNEETVVM AYLFTAFNAF 550
    QGLFIFIFHC ALQKKVRKEY GKCFRHWYCC GGLPTESPHS SVKASTTRTS 600
    ARYSSGTQSR IRRMWNDTVR KQSESSFISG DINSTSTLNQ GHSLNNARDT 650
    SAMDTLPLNG NFNNSYSLRK ADYHDGVQVV DCGLSLNDTA FEKMIISELV 700
    HNNLRGGNKT HNLELKLPVK PVIGGSSSED DAIVADASSL MHGDNPGLEF 750
    RHKELEAPLI PQRTHSLLYQ PQKKVKPEAT DSYVSQLTAE ADDHLQSPNR 800
    DSLYTSMPNL RDSPYPESSP DMAEDLSPSR RSENEDIYYK SMPNLGAGRH 850
    LHMCYQISRG NSDGYIIPIN KEGCIPEGDV REGQMQLVTS L 891
    Length:891
    Mass (Da):99,452
    Last modified:April 26, 2004 - v2
    Checksum:iC5008C6438F95389
    GO
    Isoform 2 (identifier: Q8JZZ7-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         509-509: K → NNYRVCDGYYNTDLPG
         641-641: G → GMTGNYLLTNPLLRPHGTNNPYNTLLAETVVCNAPSAPAFNSPATYRETR

    Show »
    Length:955
    Mass (Da):106,514
    Checksum:i68CBF4F016ACEF40
    GO

    Sequence cautioni

    The sequence AAH34660.1 differs from that shown. Reason: Erroneous initiation.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Non-terminal residuei1 – 11

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei509 – 5091K → NNYRVCDGYYNTDLPG in isoform 2. 1 PublicationVSP_010110
    Alternative sequencei641 – 6411G → GMTGNYLLTNPLLRPHGTNN PYNTLLAETVVCNAPSAPAF NSPATYRETR in isoform 2. 1 PublicationVSP_010111

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK129215 mRNA. Translation: BAC98025.1.
    AK034430 mRNA. Translation: BAC28707.1.
    BC034660 mRNA. Translation: AAH34660.1. Different initiation.
    UniGeneiMm.331434.
    Mm.462301.
    Mm.9776.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK129215 mRNA. Translation: BAC98025.1 .
    AK034430 mRNA. Translation: BAC28707.1 .
    BC034660 mRNA. Translation: AAH34660.1 . Different initiation.
    UniGenei Mm.331434.
    Mm.462301.
    Mm.9776.

    3D structure databases

    ProteinModelPortali Q8JZZ7.
    ModBasei Search...
    MobiDBi Search...

    Protein family/group databases

    MEROPSi S63.012.
    GPCRDBi Search...

    PTM databases

    PhosphoSitei Q8JZZ7.

    Proteomic databases

    MaxQBi Q8JZZ7.
    PaxDbi Q8JZZ7.
    PRIDEi Q8JZZ7.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Organism-specific databases

    MGIi MGI:2139714. Lphn2.
    Rougei Search...

    Phylogenomic databases

    eggNOGi NOG253931.
    HOGENOMi HOG000049065.
    HOVERGENi HBG052337.
    PhylomeDBi Q8JZZ7.

    Miscellaneous databases

    ChiTaRSi LPHN2. mouse.
    PROi Q8JZZ7.
    SOURCEi Search...

    Gene expression databases

    CleanExi MM_LPHN2.
    Genevestigatori Q8JZZ7.

    Family and domain databases

    InterProi IPR022624. DUF3497.
    IPR017981. GPCR_2-like.
    IPR003924. GPCR_2_latrophilin.
    IPR003334. GPCR_2_latrophilin_rcpt_C.
    IPR000832. GPCR_2_secretin-like.
    IPR017983. GPCR_2_secretin-like_CS.
    IPR000203. GPS.
    [Graphical view ]
    Pfami PF00002. 7tm_2. 1 hit.
    PF12003. DUF3497. 1 hit.
    PF01825. GPS. 1 hit.
    PF02354. Latrophilin. 2 hits.
    [Graphical view ]
    PRINTSi PR00249. GPCRSECRETIN.
    PR01444. LATROPHILIN.
    SMARTi SM00303. GPS. 1 hit.
    [Graphical view ]
    PROSITEi PS00650. G_PROTEIN_RECEP_F2_2. 1 hit.
    PS50261. G_PROTEIN_RECEP_F2_4. 1 hit.
    PS50221. GPS. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Prediction of the coding sequences of mouse homologues of KIAA gene: III. The complete nucleotide sequences of 500 mouse KIAA-homologous cDNAs identified by screening of terminal sequences of cDNA clones randomly sampled from size-fractionated libraries."
      Okazaki N., Kikuno R., Ohara R., Inamoto S., Koseki H., Hiraoka S., Saga Y., Nagase T., Ohara O., Koga H.
      DNA Res. 10:167-180(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Embryonic tail.
    2. Lubec G., Kang S.U.
      Submitted (APR-2007) to UniProtKB
      Cited for: PROTEIN SEQUENCE OF 211-218, IDENTIFICATION BY MASS SPECTROMETRY.
      Strain: C57BL/6.
      Tissue: Brain.
    3. "The transcriptional landscape of the mammalian genome."
      Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
      , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
      Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 486-891 (ISOFORM 2).
      Strain: C57BL/6J.
      Tissue: Diencephalon.
    4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 660-891.
      Tissue: Retina.
    5. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-806 AND SER-862, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Liver.
    6. "The mouse C2C12 myoblast cell surface N-linked glycoproteome: identification, glycosite occupancy, and membrane orientation."
      Gundry R.L., Raginski K., Tarasova Y., Tchernyshyov I., Bausch-Fluck D., Elliott S.T., Boheler K.R., Van Eyk J.E., Wollscheid B.
      Mol. Cell. Proteomics 8:2555-2569(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-206.
      Tissue: Myoblast.
    7. "Mass-spectrometric identification and relative quantification of N-linked cell surface glycoproteins."
      Wollscheid B., Bausch-Fluck D., Henderson C., O'Brien R., Bibel M., Schiess R., Aebersold R., Watts J.D.
      Nat. Biotechnol. 27:378-386(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-206.

    Entry informationi

    Entry nameiLPHN2_MOUSE
    AccessioniPrimary (citable) accession number: Q8JZZ7
    Secondary accession number(s): Q8BM90
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: April 26, 2004
    Last sequence update: April 26, 2004
    Last modified: October 1, 2014
    This is version 93 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Direct protein sequencing, Reference proteome

    Documents

    1. 7-transmembrane G-linked receptors
      List of 7-transmembrane G-linked receptor entries
    2. MGD cross-references
      Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
    3. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3