Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Adhesion G protein-coupled receptor L2

Gene

Adgrl2

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Calcium-independent receptor of low affinity for alpha-latrotoxin, an excitatory neurotoxin present in black widow spider venom which triggers massive exocytosis from neurons and neuroendocrine cells. Receptor probably implicated in the regulation of exocytosis.By similarity1 Publication

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionG-protein coupled receptor, Receptor, Transducer

Protein family/group databases

MEROPSiP02.009

Names & Taxonomyi

Protein namesi
Recommended name:
Adhesion G protein-coupled receptor L2
Alternative name(s):
Calcium-independent alpha-latrotoxin receptor 2
Short name:
CIRL-2
Latrophilin-2
Gene namesi
Name:Adgrl2
Synonyms:Kiaa0786, Lphn2
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 3

Organism-specific databases

MGIiMGI:2139714 Adgrl2

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini26 – 855ExtracellularCuratedAdd BLAST830
Transmembranei856 – 876Helical; Name=1Sequence analysisAdd BLAST21
Topological domaini877 – 884CytoplasmicCurated8
Transmembranei885 – 905Helical; Name=2Sequence analysisAdd BLAST21
Topological domaini906 – 911ExtracellularCurated6
Transmembranei912 – 932Helical; Name=3Sequence analysisAdd BLAST21
Topological domaini933 – 955CytoplasmicCuratedAdd BLAST23
Transmembranei956 – 976Helical; Name=4Sequence analysisAdd BLAST21
Topological domaini977 – 994ExtracellularCuratedAdd BLAST18
Transmembranei995 – 1015Helical; Name=5Sequence analysisAdd BLAST21
Topological domaini1016 – 1064CytoplasmicCuratedAdd BLAST49
Transmembranei1065 – 1085Helical; Name=6Sequence analysisAdd BLAST21
Topological domaini1086 – 1090ExtracellularCurated5
Transmembranei1091 – 1111Helical; Name=7Sequence analysisAdd BLAST21

Keywords - Cellular componenti

Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 25Sequence analysisAdd BLAST25
ChainiPRO_000007034326 – 1487Adhesion G protein-coupled receptor L2Add BLAST1462

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi99N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi524N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi735N-linked (GlcNAc...) asparagine2 Publications1
Modified residuei1402PhosphoserineCombined sources1
Modified residuei1437PhosphoserineCombined sources1
Modified residuei1458PhosphoserineCombined sources1

Post-translational modificationi

Proteolytically cleaved into 2 subunits, an extracellular subunit and a seven-transmembrane subunit.By similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sitei828 – 829CleavageBy similarity2

Keywords - PTMi

Glycoprotein, Phosphoprotein

Proteomic databases

PaxDbiQ8JZZ7
PeptideAtlasiQ8JZZ7
PRIDEiQ8JZZ7

PTM databases

iPTMnetiQ8JZZ7
PhosphoSitePlusiQ8JZZ7
SwissPalmiQ8JZZ7

Expressioni

Tissue specificityi

Ubiquitously expressed.1 Publication

Developmental stagei

Decrease in mRNA levels during postnatal development.1 Publication

Gene expression databases

BgeeiENSMUSG00000028184
CleanExiMM_LPHN2
ExpressionAtlasiQ8JZZ7 baseline and differential

Interactioni

Subunit structurei

Forms a heterodimer, consisting of a large extracellular region non-covalently linked to a seven-transmembrane moiety.By similarity

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000101734

Structurei

3D structure databases

ProteinModelPortaliQ8JZZ7
SMRiQ8JZZ7
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini41 – 130SUEL-type lectinPROSITE-ProRule annotationAdd BLAST90
Domaini139 – 398Olfactomedin-likePROSITE-ProRule annotationAdd BLAST260
Domaini789 – 840GPSPROSITE-ProRule annotationAdd BLAST52

Sequence similaritiesi

Keywords - Domaini

Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG3545 Eukaryota
KOG4193 Eukaryota
KOG4729 Eukaryota
ENOG410XSD2 LUCA
GeneTreeiENSGT00900000140800
HOGENOMiHOG000049065
HOVERGENiHBG052337
InParanoidiQ8JZZ7
OMAiYFNANCS
OrthoDBiEOG091G00GJ
TreeFamiTF351999

Family and domain databases

Gene3Di4.10.1240.10, 1 hit
InterProiView protein in InterPro
IPR032471 GAIN_dom_N
IPR017981 GPCR_2-like
IPR036445 GPCR_2_extracell_dom_sf
IPR001879 GPCR_2_extracellular_dom
IPR003924 GPCR_2_latrophilin
IPR003334 GPCR_2_latrophilin_rcpt_C
IPR000832 GPCR_2_secretin-like
IPR017983 GPCR_2_secretin-like_CS
IPR000203 GPS
IPR031240 Latrophilin-2
IPR000922 Lectin_gal-bd_dom
IPR003112 Olfac-like_dom
PANTHERiPTHR12011:SF61 PTHR12011:SF61, 1 hit
PfamiView protein in Pfam
PF00002 7tm_2, 1 hit
PF16489 GAIN, 1 hit
PF02140 Gal_Lectin, 1 hit
PF01825 GPS, 1 hit
PF02793 HRM, 1 hit
PF02354 Latrophilin, 1 hit
PF02191 OLF, 1 hit
PRINTSiPR00249 GPCRSECRETIN
PR01444 LATROPHILIN
SMARTiView protein in SMART
SM00303 GPS, 1 hit
SM00008 HormR, 1 hit
SM00284 OLF, 1 hit
PROSITEiView protein in PROSITE
PS00650 G_PROTEIN_RECEP_F2_2, 1 hit
PS50227 G_PROTEIN_RECEP_F2_3, 1 hit
PS50261 G_PROTEIN_RECEP_F2_4, 1 hit
PS50221 GPS, 1 hit
PS51132 OLF, 1 hit
PS50228 SUEL_LECTIN, 1 hit

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8JZZ7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MVSSGCRMRS LWFIIIISFS PSTEGFSRAA LPFGLVRREL SCEGYSIDLR
60 70 80 90 100
CPGSDVIMIE SANYGRTDDK ICDADPFQME NTDCYLPDAF KIMTQRCNNR
110 120 130 140 150
TQCIVVTGSD VFPDPCPGTY KYLEVQYECV PYSKMLVFVC PGTLKAIVDS
160 170 180 190 200
PCIYEAEQKS GAWCKDPLQA ADKIYFMPWT PYRTDTLIEY ASLEDFQNSR
210 220 230 240 250
QTTTYKLPNR VDGTGFVVYD GAVFFNKERT RNIVKFDLRT RIKSGEAIIN
260 270 280 290 300
YANYHDTSPY RWGGKTDIDL AVDENGLWVI YATEQNNGMI VISQLNPYTL
310 320 330 340 350
RFEATWETAY DKRAASNAFM ICGVLYVVRS VYQDNESEAG KNTIDYIYNT
360 370 380 390 400
RLSRGEYVDV PFPNQYQYIA AVDYNPRDNQ LYVWNNNFIL RYSLEFGPPD
410 420 430 440 450
PAQVPTTAVT ITSSAELFKT TISTTSSASQ RGPVSSTAAG PQDGSRGTKP
460 470 480 490 500
PPAVSTTKIP PVTNIFPLPE RFCEALDWKG IKWPQTQRGM MVERPCPKGT
510 520 530 540 550
RGTASYLCMA STGTWNPKGP DLSNCTSHWV NQLAQKIRSG ENAASLANEL
560 570 580 590 600
AKHTKGHVFA GDVSSSVRLM EQLVDILDAQ LQELKPSEKD SAGRSYNKLQ
610 620 630 640 650
KREKTCRAYL KAIVDTVDNL LRAEALESWK HMNSSEQAHT ATMLLDTLEE
660 670 680 690 700
GAFVLADNLL EPTRVSMPTE NIVLEVAVLS TEGQVQDFKF PLGLKGLGSS
710 720 730 740 750
IQLSANTVKQ NSRNGLAKLV FIIYRSLGQF LSTENATIKL GADLMGRNST
760 770 780 790 800
IAVNSPVISV SINKESSRVY LTDPVLFTLP HIDPDNYFNA NCSFWNYSER
810 820 830 840 850
TMMGYWSTQG CKLVDTNKTR TTCACSHLTN FAILMAHREI AYKDGVHHLL
860 870 880 890 900
LTVITWVGIV VSLVCLAICI FTFCFFRGLQ SDRNTIHKNL CINLFIAEFI
910 920 930 940 950
FLIGIDKTKY TIACPVFAGL LHFFFLAAFS WMCLEGVQLY LMLVEVFESE
960 970 980 990 1000
YSRKKYYYVA GYLFPATVVG VSAAIDYKSY GTVQACWLHV DNYFIWSFIG
1010 1020 1030 1040 1050
PVTFIILLNI IFLVITLCKM VKHSNTLKPD SSRLENINNY RVCDGYYNTD
1060 1070 1080 1090 1100
LPGYEDNKPF IKSWVLGAFA LLCLLGLTWS FGLLFVNEET VVMAYLFTAF
1110 1120 1130 1140 1150
NAFQGLFIFI FHCALQKKVR KEYGKCFRHW YCCGGLPTES PHSSVKASTT
1160 1170 1180 1190 1200
RTSARYSSGT QSRIRRMWND TVRKQSESSF ISGDINSTST LNQGMTGNYL
1210 1220 1230 1240 1250
LTNPLLRPHG TNNPYNTLLA ETVVCNAPSA PAFNSPGHSL NNARDTSAMD
1260 1270 1280 1290 1300
TLPLNGNFNN SYSLRKADYH DGVQVVDCGL SLNDTAFEKM IISELVHNNL
1310 1320 1330 1340 1350
RGGNKTHNLE LKLPVKPVIG GSSSEDDAIV ADASSLMHGD NPGLEFRHKE
1360 1370 1380 1390 1400
LEAPLIPQRT HSLLYQPQKK VKPEATDSYV SQLTAEADDH LQSPNRDSLY
1410 1420 1430 1440 1450
TSMPNLRDSP YPESSPDMAE DLSPSRRSEN EDIYYKSMPN LGAGRHLHMC
1460 1470 1480
YQISRGNSDG YIIPINKEGC IPEGDVREGQ MQLVTSL
Length:1,487
Mass (Da):166,577
Last modified:June 24, 2015 - v3
Checksum:iA56F7A5409E801F8
GO
Isoform 2 (identifier: Q8JZZ7-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1062-1062: K → NNYRVCDGYYNTDLPG
     1194-1194: G → GMTGNYLLTNPLLRPHGTNNPYNTLLAETVVCNAPSAPAFNSPATYRETR

Show »
Length:1,551
Mass (Da):173,640
Checksum:iE74F891832FBABBC
GO

Sequence cautioni

The sequence AAH34660 differs from that shown. Reason: Erroneous initiation.Curated

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0101101062K → NNYRVCDGYYNTDLPG in isoform 2. 1 Publication1
Alternative sequenceiVSP_0101111194G → GMTGNYLLTNPLLRPHGTNN PYNTLLAETVVCNAPSAPAF NSPATYRETR in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AC113315 Genomic DNA No translation available.
AC114679 Genomic DNA No translation available.
AC138591 Genomic DNA No translation available.
AK129215 mRNA Translation: BAC98025.1
AK034430 mRNA Translation: BAC28707.1
BC034660 mRNA Translation: AAH34660.1 Different initiation.
CCDSiCCDS80059.1 [Q8JZZ7-1]
UniGeneiMm.331434
Mm.389502
Mm.462301
Mm.9776

Genome annotation databases

EnsembliENSMUST00000106128; ENSMUSP00000101734; ENSMUSG00000028184 [Q8JZZ7-1]
UCSCiuc008rsa.1 mouse [Q8JZZ7-1]
uc008rsb.1 mouse

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiAGRL2_MOUSE
AccessioniPrimary (citable) accession number: Q8JZZ7
Secondary accession number(s): E9Q6C7, Q8BM90
Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 26, 2004
Last sequence update: June 24, 2015
Last modified: May 23, 2018
This is version 119 of the entry and version 3 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. 7-transmembrane G-linked receptors
    List of 7-transmembrane G-linked receptor entries
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

Cookie policy

We would like to use anonymized google analytics cookies to gather statistics on how uniprot.org is used in aggregate. Learn more

UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health