Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q8JZZ7

- LPHN2_MOUSE

UniProt

Q8JZZ7 - LPHN2_MOUSE

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Latrophilin-2

Gene

Lphn2

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 4 out of 5- Experimental evidence at protein leveli

Functioni

Calcium-independent receptor of low affinity for alpha-latrotoxin, an excitatory neurotoxin present in black widow spider venom which triggers massive exocytosis from neurons and neuroendocrine cells. Receptor propably implicated in the regulation of exocytosis (By similarity).By similarity

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sitei299 – 3002CleavageBy similarity

GO - Molecular functioni

  1. G-protein coupled receptor activity Source: UniProtKB-KW

GO - Biological processi

  1. neuropeptide signaling pathway Source: InterPro
Complete GO annotation...

Keywords - Molecular functioni

G-protein coupled receptor, Receptor, Transducer

Protein family/group databases

MEROPSiS63.012.

Names & Taxonomyi

Protein namesi
Recommended name:
Latrophilin-2
Alternative name(s):
Calcium-independent alpha-latrotoxin receptor 2
Short name:
CIRL-2
Gene namesi
Name:Lphn2
Synonyms:Kiaa0786
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
ProteomesiUP000000589: Unplaced

Organism-specific databases

MGIiMGI:2139714. Lphn2.

Subcellular locationi

GO - Cellular componenti

  1. integral component of membrane Source: UniProtKB-KW
  2. plasma membrane Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini‹1 – 891›891Latrophilin-2PRO_0000070343Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi8 – 81N-linked (GlcNAc...)Sequence Analysis
Glycosylationi104 – 1041N-linked (GlcNAc...)Sequence Analysis
Glycosylationi206 – 2061N-linked (GlcNAc...)2 Publications
Glycosylationi219 – 2191N-linked (GlcNAc...)Sequence Analysis
Glycosylationi262 – 2621N-linked (GlcNAc...)Sequence Analysis
Glycosylationi267 – 2671N-linked (GlcNAc...)Sequence Analysis
Glycosylationi288 – 2881N-linked (GlcNAc...)Sequence Analysis
Modified residuei806 – 8061Phosphoserine1 Publication
Modified residuei862 – 8621Phosphoserine1 Publication

Post-translational modificationi

Proteolytically cleaved into 2 subunits, an extracellular subunit and a seven-transmembrane subunit.By similarity

Keywords - PTMi

Glycoprotein, Phosphoprotein

Proteomic databases

MaxQBiQ8JZZ7.
PaxDbiQ8JZZ7.
PRIDEiQ8JZZ7.

PTM databases

PhosphoSiteiQ8JZZ7.

Expressioni

Gene expression databases

CleanExiMM_LPHN2.
GenevestigatoriQ8JZZ7.

Interactioni

Subunit structurei

Forms a heterodimer, consisting of a large extracellular region (p120) non-covalently linked to a seven-transmembrane moiety (p85).By similarity

Structurei

3D structure databases

ProteinModelPortaliQ8JZZ7.
ModBaseiSearch...
MobiDBiSearch...

Topological domain

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini‹1 – 326›326ExtracellularSequence AnalysisAdd
BLAST
Topological domaini348 – 3558CytoplasmicSequence Analysis
Topological domaini377 – 3826ExtracellularSequence Analysis
Topological domaini404 – 42623CytoplasmicSequence AnalysisAdd
BLAST
Topological domaini448 – 46518ExtracellularSequence AnalysisAdd
BLAST
Topological domaini487 – 51226CytoplasmicSequence AnalysisAdd
BLAST
Topological domaini534 – 5374ExtracellularSequence Analysis
Topological domaini559 – 891333CytoplasmicSequence AnalysisAdd
BLAST

Transmembrane

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transmembranei327 – 34721Helical; Name=1Sequence AnalysisAdd
BLAST
Transmembranei356 – 37621Helical; Name=2Sequence AnalysisAdd
BLAST
Transmembranei383 – 40321Helical; Name=3Sequence AnalysisAdd
BLAST
Transmembranei427 – 44721Helical; Name=4Sequence AnalysisAdd
BLAST
Transmembranei466 – 48621Helical; Name=5Sequence AnalysisAdd
BLAST
Transmembranei513 – 53321Helical; Name=6Sequence AnalysisAdd
BLAST
Transmembranei538 – 55821Helical; Name=7Sequence AnalysisAdd
BLAST

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini260 – 31152GPSPROSITE-ProRule annotationAdd
BLAST

Sequence similaritiesi

Contains 1 GPS domain.PROSITE-ProRule annotation

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG253931.
HOGENOMiHOG000049065.
HOVERGENiHBG052337.
InParanoidiQ8JZZ7.
PhylomeDBiQ8JZZ7.

Family and domain databases

InterProiIPR022624. DUF3497.
IPR017981. GPCR_2-like.
IPR003924. GPCR_2_latrophilin.
IPR003334. GPCR_2_latrophilin_rcpt_C.
IPR000832. GPCR_2_secretin-like.
IPR017983. GPCR_2_secretin-like_CS.
IPR000203. GPS.
[Graphical view]
PfamiPF00002. 7tm_2. 1 hit.
PF12003. DUF3497. 1 hit.
PF01825. GPS. 1 hit.
PF02354. Latrophilin. 2 hits.
[Graphical view]
PRINTSiPR00249. GPCRSECRETIN.
PR01444. LATROPHILIN.
SMARTiSM00303. GPS. 1 hit.
[Graphical view]
PROSITEiPS00650. G_PROTEIN_RECEP_F2_2. 1 hit.
PS50261. G_PROTEIN_RECEP_F2_4. 1 hit.
PS50221. GPS. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Fragment.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q8JZZ7-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
PKGPDLSNCT SHWVNQLAQK IRSGENAASL ANELAKHTKG HVFAGDVSSS
60 70 80 90 100
VRLMEQLVDI LDAQLQELKP SEKDSAGRSY NKAIVDTVDN LLRAEALESW
110 120 130 140 150
KHMNSSEQAH TATMLLDTLE EGAFVLADNL LEPTRVSMPT ENIVLEVAVL
160 170 180 190 200
STEGQVQDFK FPLGLKGLGS SIQLSANTVK QNSRNGLAKL VFIIYRSLGQ
210 220 230 240 250
FLSTENATIK LGADLMGRNS TIAVNSPVIS VSINKESSRV YLTDPVLFTL
260 270 280 290 300
PHIDPDNYFN ANCSFWNYSE RTMMGYWSTQ GCKLVDTNKT RTTCACSHLT
310 320 330 340 350
NFAILMAHRE IAYKDGVHHL LLTVITWVGI VVSLVCLAIC IFTFCFFRGL
360 370 380 390 400
QSDRNTIHKN LCINLFIAEF IFLIGIDKTK YTIACPVFAG LLHFFFLAAF
410 420 430 440 450
SWMCLEGVQL YLMLVEVFES EYSRKKYYYV AGYLFPATVV GVSAAIDYKS
460 470 480 490 500
YGTVQACWLH VDNYFIWSFI GPVTFIILLN IIFLVITLCK MVKHSNTLKP
510 520 530 540 550
DSSRLENIKS WVLGAFALLC LLGLTWSFGL LFVNEETVVM AYLFTAFNAF
560 570 580 590 600
QGLFIFIFHC ALQKKVRKEY GKCFRHWYCC GGLPTESPHS SVKASTTRTS
610 620 630 640 650
ARYSSGTQSR IRRMWNDTVR KQSESSFISG DINSTSTLNQ GHSLNNARDT
660 670 680 690 700
SAMDTLPLNG NFNNSYSLRK ADYHDGVQVV DCGLSLNDTA FEKMIISELV
710 720 730 740 750
HNNLRGGNKT HNLELKLPVK PVIGGSSSED DAIVADASSL MHGDNPGLEF
760 770 780 790 800
RHKELEAPLI PQRTHSLLYQ PQKKVKPEAT DSYVSQLTAE ADDHLQSPNR
810 820 830 840 850
DSLYTSMPNL RDSPYPESSP DMAEDLSPSR RSENEDIYYK SMPNLGAGRH
860 870 880 890
LHMCYQISRG NSDGYIIPIN KEGCIPEGDV REGQMQLVTS L
Length:891
Mass (Da):99,452
Last modified:April 26, 2004 - v2
Checksum:iC5008C6438F95389
GO
Isoform 2 (identifier: Q8JZZ7-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     509-509: K → NNYRVCDGYYNTDLPG
     641-641: G → GMTGNYLLTNPLLRPHGTNNPYNTLLAETVVCNAPSAPAFNSPATYRETR

Show »
Length:955
Mass (Da):106,514
Checksum:i68CBF4F016ACEF40
GO

Sequence cautioni

The sequence AAH34660.1 differs from that shown. Reason: Erroneous initiation.

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Non-terminal residuei1 – 11

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei509 – 5091K → NNYRVCDGYYNTDLPG in isoform 2. 1 PublicationVSP_010110
Alternative sequencei641 – 6411G → GMTGNYLLTNPLLRPHGTNN PYNTLLAETVVCNAPSAPAF NSPATYRETR in isoform 2. 1 PublicationVSP_010111

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AK129215 mRNA. Translation: BAC98025.1.
AK034430 mRNA. Translation: BAC28707.1.
BC034660 mRNA. Translation: AAH34660.1. Different initiation.
UniGeneiMm.331434.
Mm.462301.
Mm.9776.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AK129215 mRNA. Translation: BAC98025.1 .
AK034430 mRNA. Translation: BAC28707.1 .
BC034660 mRNA. Translation: AAH34660.1 . Different initiation.
UniGenei Mm.331434.
Mm.462301.
Mm.9776.

3D structure databases

ProteinModelPortali Q8JZZ7.
ModBasei Search...
MobiDBi Search...

Protein family/group databases

MEROPSi S63.012.
GPCRDBi Search...

PTM databases

PhosphoSitei Q8JZZ7.

Proteomic databases

MaxQBi Q8JZZ7.
PaxDbi Q8JZZ7.
PRIDEi Q8JZZ7.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Organism-specific databases

MGIi MGI:2139714. Lphn2.
Rougei Search...

Phylogenomic databases

eggNOGi NOG253931.
HOGENOMi HOG000049065.
HOVERGENi HBG052337.
InParanoidi Q8JZZ7.
PhylomeDBi Q8JZZ7.

Miscellaneous databases

ChiTaRSi LPHN2. mouse.
PROi Q8JZZ7.
SOURCEi Search...

Gene expression databases

CleanExi MM_LPHN2.
Genevestigatori Q8JZZ7.

Family and domain databases

InterProi IPR022624. DUF3497.
IPR017981. GPCR_2-like.
IPR003924. GPCR_2_latrophilin.
IPR003334. GPCR_2_latrophilin_rcpt_C.
IPR000832. GPCR_2_secretin-like.
IPR017983. GPCR_2_secretin-like_CS.
IPR000203. GPS.
[Graphical view ]
Pfami PF00002. 7tm_2. 1 hit.
PF12003. DUF3497. 1 hit.
PF01825. GPS. 1 hit.
PF02354. Latrophilin. 2 hits.
[Graphical view ]
PRINTSi PR00249. GPCRSECRETIN.
PR01444. LATROPHILIN.
SMARTi SM00303. GPS. 1 hit.
[Graphical view ]
PROSITEi PS00650. G_PROTEIN_RECEP_F2_2. 1 hit.
PS50261. G_PROTEIN_RECEP_F2_4. 1 hit.
PS50221. GPS. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Prediction of the coding sequences of mouse homologues of KIAA gene: III. The complete nucleotide sequences of 500 mouse KIAA-homologous cDNAs identified by screening of terminal sequences of cDNA clones randomly sampled from size-fractionated libraries."
    Okazaki N., Kikuno R., Ohara R., Inamoto S., Koseki H., Hiraoka S., Saga Y., Nagase T., Ohara O., Koga H.
    DNA Res. 10:167-180(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Embryonic tail.
  2. Lubec G., Kang S.U.
    Submitted (APR-2007) to UniProtKB
    Cited for: PROTEIN SEQUENCE OF 211-218, IDENTIFICATION BY MASS SPECTROMETRY.
    Strain: C57BL/6.
    Tissue: Brain.
  3. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 486-891 (ISOFORM 2).
    Strain: C57BL/6J.
    Tissue: Diencephalon.
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 660-891.
    Tissue: Retina.
  5. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-806 AND SER-862, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Liver.
  6. "The mouse C2C12 myoblast cell surface N-linked glycoproteome: identification, glycosite occupancy, and membrane orientation."
    Gundry R.L., Raginski K., Tarasova Y., Tchernyshyov I., Bausch-Fluck D., Elliott S.T., Boheler K.R., Van Eyk J.E., Wollscheid B.
    Mol. Cell. Proteomics 8:2555-2569(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-206.
    Tissue: Myoblast.
  7. "Mass-spectrometric identification and relative quantification of N-linked cell surface glycoproteins."
    Wollscheid B., Bausch-Fluck D., Henderson C., O'Brien R., Bibel M., Schiess R., Aebersold R., Watts J.D.
    Nat. Biotechnol. 27:378-386(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-206.

Entry informationi

Entry nameiLPHN2_MOUSE
AccessioniPrimary (citable) accession number: Q8JZZ7
Secondary accession number(s): Q8BM90
Entry historyi
Integrated into UniProtKB/Swiss-Prot: April 26, 2004
Last sequence update: April 26, 2004
Last modified: October 29, 2014
This is version 94 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. 7-transmembrane G-linked receptors
    List of 7-transmembrane G-linked receptor entries
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3