Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Protein FAM9B

Gene

FAM9B

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

GO - Biological processi

Complete GO annotation...

Names & Taxonomyi

Protein namesi
Recommended name:
Protein FAM9B
Gene namesi
Name:FAM9B
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome X

Organism-specific databases

HGNCiHGNC:18404. FAM9B.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA27993.

Polymorphism and mutation databases

BioMutaiFAM9B.
DMDMi29336758.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 186186Protein FAM9BPRO_0000119033Add
BLAST

Proteomic databases

PaxDbiQ8IZU0.
PRIDEiQ8IZU0.

Expressioni

Tissue specificityi

Expressed exclusively in testis.1 Publication

Gene expression databases

BgeeiQ8IZU0.
CleanExiHS_FAM9B.
ExpressionAtlasiQ8IZU0. baseline and differential.
GenevisibleiQ8IZU0. HS.

Organism-specific databases

HPAiHPA035135.

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
A8KAD63EBI-10175124,EBI-10174974
Q9H6143EBI-10175124,EBI-10249899
ABT1Q9ULW33EBI-10175124,EBI-2602396
ANKRD36BQ8N2N93EBI-10175124,EBI-2876112
AP1M1Q9BXS53EBI-10175124,EBI-541426
ASB6Q9NWX53EBI-10175124,EBI-6425205
ATF7P175443EBI-10175124,EBI-765623
AURKAIP1Q9NWT83EBI-10175124,EBI-448665
BAG6P463793EBI-10175124,EBI-347552
BARD1Q997283EBI-10175124,EBI-473181
BCL2A1Q165483EBI-10175124,EBI-1003550
BET1Q53XK03EBI-10175124,EBI-10242927
BLOC1S2Q6QNY13EBI-10175124,EBI-465872
BYSLQ138955EBI-10175124,EBI-358049
C12orf10Q86UA33EBI-10175124,EBI-10258793
C14orf105Q17R993EBI-10175124,EBI-10238351
C16orf72Q14CZ03EBI-10175124,EBI-10234807
C19orf57Q0VDD73EBI-10175124,EBI-741210
C20orf195Q9BVV23EBI-10175124,EBI-744935
C8orf33Q9H7E93EBI-10175124,EBI-715389
CADPSQ9ULU8-43EBI-10175124,EBI-10180690
CCDC106Q9BWC93EBI-10175124,EBI-711501
CCDC116Q8IYX33EBI-10175124,EBI-744311
CCDC70Q6NSX13EBI-10175124,EBI-6873045
CDC23Q9UJX23EBI-10175124,EBI-396137
CDC42EP4Q9H3Q13EBI-10175124,EBI-744665
CDCA7LQ96GN53EBI-10175124,EBI-5278764
CENPLQ8N0S63EBI-10175124,EBI-8467109
CEP57L1Q8IYX8-23EBI-10175124,EBI-10181988
CEP95Q96GE43EBI-10175124,EBI-372775
CHRAC1Q9NRG03EBI-10175124,EBI-2795492
CLCN1P355233EBI-10175124,EBI-10206780
COL20A1Q9P218-23EBI-10175124,EBI-10318410
CSDE1O755343EBI-10175124,EBI-719186
DAPK2Q9UIK43EBI-10175124,EBI-77154
DAXXQ9UER73EBI-10175124,EBI-77321
DENND2DQ9H6A03EBI-10175124,EBI-10307465
DNAJC15Q9Y5T43EBI-10175124,EBI-10329228
DNAJC4Q96FY53EBI-10175124,EBI-10286235
EBNA1BP2Q6IB293EBI-10175124,EBI-10249955
ECH1Q130113EBI-10175124,EBI-711968
EIF3GO758213EBI-10175124,EBI-366632
FAM161AQ3B8203EBI-10175124,EBI-719941
FASTKD3Q14CZ73EBI-10175124,EBI-10234819
FCHSD2O948683EBI-10175124,EBI-1215612
FERD3LQ96RJ63EBI-10175124,EBI-10183007
GFOD1Q9NXC23EBI-10175124,EBI-8799578
GSTK1Q9Y2Q33EBI-10175124,EBI-1053767
ISCUQ9H1K13EBI-10175124,EBI-1047335
LIN7AO149103EBI-10175124,EBI-2513988
LNX1Q8TBB13EBI-10175124,EBI-739832
LYRM2Q9NU233EBI-10175124,EBI-10313813
MAB21L3Q8N8X93EBI-10175124,EBI-10268010
MFAP1P550813EBI-10175124,EBI-1048159
MGC24125Q8NEQ23EBI-10175124,EBI-10270788
MOB1AQ9H8S93EBI-10175124,EBI-748229
MORF4L1Q9UBU83EBI-10175124,EBI-399246
MORF4L2Q150143EBI-10175124,EBI-399257
MRPL10Q7Z7H83EBI-10175124,EBI-723524
MRPL28Q130843EBI-10175124,EBI-723426
MRPL9Q9BYD23EBI-10175124,EBI-726059
NDUFB10O960003EBI-10175124,EBI-1246371
NEBLO760413EBI-10175124,EBI-2880203
NOL4O94818-23EBI-10175124,EBI-10190763
PAGE1O754593EBI-10175124,EBI-2559100
PAGE3Q5JUK93EBI-10175124,EBI-10244544
PHYHO148323EBI-10175124,EBI-721853
PIN4Q9Y2373EBI-10175124,EBI-714599
POLLQ9UGP5-23EBI-10175124,EBI-10320765
PPP1R18Q6NYC83EBI-10175124,EBI-2557469
PRPF3O433953EBI-10175124,EBI-744322
PSMD14O004873EBI-10175124,EBI-722193
PTRH1Q86Y793EBI-10175124,EBI-2602515
RAB17Q9H0T73EBI-10175124,EBI-721615
RAD51BO153153EBI-10175124,EBI-2824089
RBM17Q96I253EBI-10175124,EBI-740272
RBM23Q86U063EBI-10175124,EBI-780319
RMND1Q9NWS83EBI-10175124,EBI-4401316
RPL9P329693EBI-10175124,EBI-358122
RSL24D1Q9UHA33EBI-10175124,EBI-749321
RUSC1Q9BVN23EBI-10175124,EBI-6257312
SDCBPO005603EBI-10175124,EBI-727004
SDCBP2Q9H1903EBI-10175124,EBI-742426
SERPINE2P070933EBI-10175124,EBI-10195168
SFNP319473EBI-10175124,EBI-476295
SLC16A3O154273EBI-10175124,EBI-7600166
SLPIP039733EBI-10175124,EBI-355293
SMN2Q166375EBI-10175124,EBI-395421
SNAP29O957213EBI-10175124,EBI-490676
SNAP47Q5SQN13EBI-10175124,EBI-10244848
SNX20Q7Z6143EBI-10175124,EBI-744896
STK3Q131883EBI-10175124,EBI-992580
SUCLA2E5KS603EBI-10175124,EBI-10176959
SYT17Q9BSW73EBI-10175124,EBI-745392
TBRG4Q969Z03EBI-10175124,EBI-702328
TCEA2Q155603EBI-10175124,EBI-710310
TCEANCQ8N8B73EBI-10175124,EBI-954696
TCEB3Q142413EBI-10175124,EBI-742350
TGFBIQ155823EBI-10175124,EBI-10236573
TRMT61BQ9BVS53EBI-10175124,EBI-3197877
TSG101Q998163EBI-10175124,EBI-346882
TUFMP494113EBI-10175124,EBI-359097
TXN2Q997573EBI-10175124,EBI-2932492
UBE2E2Q96LR53EBI-10175124,EBI-2129763
URB1-AS1Q96HZ73EBI-10175124,EBI-10288943
XRCC4Q134263EBI-10175124,EBI-717592
YARS2Q9Y2Z43EBI-10175124,EBI-1049286
ZCCHC10Q8TBK63EBI-10175124,EBI-597063
ZGPATQ8N5A53EBI-10175124,EBI-3439227
ZGPATQ8N5A5-23EBI-10175124,EBI-10183064
ZNF41P518143EBI-10175124,EBI-2681830
ZNF410Q86VK43EBI-10175124,EBI-720304
ZNF567Q8N1843EBI-10175124,EBI-749400
ZNF614Q8N8833EBI-10175124,EBI-9675993

Protein-protein interaction databases

BioGridi128131. 119 interactions.
IntActiQ8IZU0. 114 interactions.
STRINGi9606.ENSP00000318716.

Structurei

3D structure databases

ProteinModelPortaliQ8IZU0.
SMRiQ8IZU0. Positions 63-184.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the FAM9 family.Curated

Phylogenomic databases

eggNOGiENOG410IV0Y. Eukaryota.
ENOG41112SU. LUCA.
GeneTreeiENSGT00390000003272.
HOGENOMiHOG000112495.
HOVERGENiHBG096021.
InParanoidiQ8IZU0.
OMAiRMKMDKA.
OrthoDBiEOG7BKCW3.
PhylomeDBiQ8IZU0.
TreeFamiTF328876.

Family and domain databases

InterProiIPR006888. XLR/SYCP3/FAM9_dom.
[Graphical view]
PfamiPF04803. Cor1. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8IZU0-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAAWGKKHAG KDPVRDECEE RNRFTETREE DVTDEHGERE PFAETDEHTG
60 70 80 90 100
ANTKKPEDTA EDLTAKRKRM KMDKTCSKTK NKSKHALRKK QLKRQKRDYI
110 120 130 140 150
HSLKLLNVLE EYITDEQKEE EEEEGEEEEL IRIFQEQQKK WQQYRSVRRE
160 170 180
RLKEMKLLRD QFVKALEDFE DLCDRVFSDE DSELDN
Length:186
Mass (Da):22,438
Last modified:March 1, 2003 - v1
Checksum:i234509A205433927
GO
Isoform 2 (identifier: Q8IZU0-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MPGFLSFLSVSLRSPGSGIASSFPGQPATDPVGRRAAKAQLEAQFM
     61-93: EDLTAKRKRMKMDKTCSKTKNKSKHALRKKQLK → VGANNFKNYPVHIGVSSEQHILLDCSLS

Note: No experimental confirmation available.
Show »
Length:226
Mass (Da):26,138
Checksum:iC4695621D44547BE
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 11M → MPGFLSFLSVSLRSPGSGIA SSFPGQPATDPVGRRAAKAQ LEAQFM in isoform 2. 1 PublicationVSP_055087
Alternative sequencei61 – 9333EDLTA…KKQLK → VGANNFKNYPVHIGVSSEQH ILLDCSLS in isoform 2. 1 PublicationVSP_055088Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF494344 mRNA. Translation: AAN07163.1.
AK097501 mRNA. Translation: BAC05078.1.
AC074281 Genomic DNA. No translation available.
AC119567 Genomic DNA. No translation available.
AC119618 Genomic DNA. No translation available.
CH471074 Genomic DNA. Translation: EAW98763.1.
BC120955 mRNA. Translation: AAI20956.1.
BC120956 mRNA. Translation: AAI20957.1.
CCDSiCCDS14132.1. [Q8IZU0-1]
RefSeqiNP_995321.1. NM_205849.3. [Q8IZU0-1]
XP_011543766.1. XM_011545464.1. [Q8IZU0-1]
UniGeneiHs.733351.

Genome annotation databases

EnsembliENST00000327220; ENSP00000318716; ENSG00000177138. [Q8IZU0-1]
ENST00000362066; ENSP00000354770; ENSG00000177138. [Q8IZU0-2]
ENST00000428477; ENSP00000412606; ENSG00000177138. [Q8IZU0-1]
GeneIDi171483.
KEGGihsa:171483.
UCSCiuc004csh.4. human. [Q8IZU0-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF494344 mRNA. Translation: AAN07163.1.
AK097501 mRNA. Translation: BAC05078.1.
AC074281 Genomic DNA. No translation available.
AC119567 Genomic DNA. No translation available.
AC119618 Genomic DNA. No translation available.
CH471074 Genomic DNA. Translation: EAW98763.1.
BC120955 mRNA. Translation: AAI20956.1.
BC120956 mRNA. Translation: AAI20957.1.
CCDSiCCDS14132.1. [Q8IZU0-1]
RefSeqiNP_995321.1. NM_205849.3. [Q8IZU0-1]
XP_011543766.1. XM_011545464.1. [Q8IZU0-1]
UniGeneiHs.733351.

3D structure databases

ProteinModelPortaliQ8IZU0.
SMRiQ8IZU0. Positions 63-184.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi128131. 119 interactions.
IntActiQ8IZU0. 114 interactions.
STRINGi9606.ENSP00000318716.

Polymorphism and mutation databases

BioMutaiFAM9B.
DMDMi29336758.

Proteomic databases

PaxDbiQ8IZU0.
PRIDEiQ8IZU0.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000327220; ENSP00000318716; ENSG00000177138. [Q8IZU0-1]
ENST00000362066; ENSP00000354770; ENSG00000177138. [Q8IZU0-2]
ENST00000428477; ENSP00000412606; ENSG00000177138. [Q8IZU0-1]
GeneIDi171483.
KEGGihsa:171483.
UCSCiuc004csh.4. human. [Q8IZU0-1]

Organism-specific databases

CTDi171483.
GeneCardsiFAM9B.
HGNCiHGNC:18404. FAM9B.
HPAiHPA035135.
MIMi300478. gene.
neXtProtiNX_Q8IZU0.
PharmGKBiPA27993.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IV0Y. Eukaryota.
ENOG41112SU. LUCA.
GeneTreeiENSGT00390000003272.
HOGENOMiHOG000112495.
HOVERGENiHBG096021.
InParanoidiQ8IZU0.
OMAiRMKMDKA.
OrthoDBiEOG7BKCW3.
PhylomeDBiQ8IZU0.
TreeFamiTF328876.

Miscellaneous databases

GenomeRNAii171483.
NextBioi89258.
PROiQ8IZU0.
SOURCEiSearch...

Gene expression databases

BgeeiQ8IZU0.
CleanExiHS_FAM9B.
ExpressionAtlasiQ8IZU0. baseline and differential.
GenevisibleiQ8IZU0. HS.

Family and domain databases

InterProiIPR006888. XLR/SYCP3/FAM9_dom.
[Graphical view]
PfamiPF04803. Cor1. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "A new gene family (FAM9) of low-copy repeats in Xp22.3 expressed exclusively in testis: implications for recombinations in this region."
    Martinez-Garay I., Jablonka S., Sutajova M., Steuernagel P., Gal A., Kutsche K.
    Genomics 80:259-267(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY, SUBCELLULAR LOCATION.
  2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Testis.
  3. "The DNA sequence of the human X chromosome."
    Ross M.T., Grafham D.V., Coffey A.J., Scherer S., McLay K., Muzny D., Platzer M., Howell G.R., Burrows C., Bird C.P., Frankish A., Lovell F.L., Howe K.L., Ashurst J.L., Fulton R.S., Sudbrak R., Wen G., Jones M.C.
    , Hurles M.E., Andrews T.D., Scott C.E., Searle S., Ramser J., Whittaker A., Deadman R., Carter N.P., Hunt S.E., Chen R., Cree A., Gunaratne P., Havlak P., Hodgson A., Metzker M.L., Richards S., Scott G., Steffen D., Sodergren E., Wheeler D.A., Worley K.C., Ainscough R., Ambrose K.D., Ansari-Lari M.A., Aradhya S., Ashwell R.I., Babbage A.K., Bagguley C.L., Ballabio A., Banerjee R., Barker G.E., Barlow K.F., Barrett I.P., Bates K.N., Beare D.M., Beasley H., Beasley O., Beck A., Bethel G., Blechschmidt K., Brady N., Bray-Allen S., Bridgeman A.M., Brown A.J., Brown M.J., Bonnin D., Bruford E.A., Buhay C., Burch P., Burford D., Burgess J., Burrill W., Burton J., Bye J.M., Carder C., Carrel L., Chako J., Chapman J.C., Chavez D., Chen E., Chen G., Chen Y., Chen Z., Chinault C., Ciccodicola A., Clark S.Y., Clarke G., Clee C.M., Clegg S., Clerc-Blankenburg K., Clifford K., Cobley V., Cole C.G., Conquer J.S., Corby N., Connor R.E., David R., Davies J., Davis C., Davis J., Delgado O., Deshazo D., Dhami P., Ding Y., Dinh H., Dodsworth S., Draper H., Dugan-Rocha S., Dunham A., Dunn M., Durbin K.J., Dutta I., Eades T., Ellwood M., Emery-Cohen A., Errington H., Evans K.L., Faulkner L., Francis F., Frankland J., Fraser A.E., Galgoczy P., Gilbert J., Gill R., Gloeckner G., Gregory S.G., Gribble S., Griffiths C., Grocock R., Gu Y., Gwilliam R., Hamilton C., Hart E.A., Hawes A., Heath P.D., Heitmann K., Hennig S., Hernandez J., Hinzmann B., Ho S., Hoffs M., Howden P.J., Huckle E.J., Hume J., Hunt P.J., Hunt A.R., Isherwood J., Jacob L., Johnson D., Jones S., de Jong P.J., Joseph S.S., Keenan S., Kelly S., Kershaw J.K., Khan Z., Kioschis P., Klages S., Knights A.J., Kosiura A., Kovar-Smith C., Laird G.K., Langford C., Lawlor S., Leversha M., Lewis L., Liu W., Lloyd C., Lloyd D.M., Loulseged H., Loveland J.E., Lovell J.D., Lozado R., Lu J., Lyne R., Ma J., Maheshwari M., Matthews L.H., McDowall J., McLaren S., McMurray A., Meidl P., Meitinger T., Milne S., Miner G., Mistry S.L., Morgan M., Morris S., Mueller I., Mullikin J.C., Nguyen N., Nordsiek G., Nyakatura G., O'dell C.N., Okwuonu G., Palmer S., Pandian R., Parker D., Parrish J., Pasternak S., Patel D., Pearce A.V., Pearson D.M., Pelan S.E., Perez L., Porter K.M., Ramsey Y., Reichwald K., Rhodes S., Ridler K.A., Schlessinger D., Schueler M.G., Sehra H.K., Shaw-Smith C., Shen H., Sheridan E.M., Shownkeen R., Skuce C.D., Smith M.L., Sotheran E.C., Steingruber H.E., Steward C.A., Storey R., Swann R.M., Swarbreck D., Tabor P.E., Taudien S., Taylor T., Teague B., Thomas K., Thorpe A., Timms K., Tracey A., Trevanion S., Tromans A.C., d'Urso M., Verduzco D., Villasana D., Waldron L., Wall M., Wang Q., Warren J., Warry G.L., Wei X., West A., Whitehead S.L., Whiteley M.N., Wilkinson J.E., Willey D.L., Williams G., Williams L., Williamson A., Williamson H., Wilming L., Woodmansey R.L., Wray P.W., Yen J., Zhang J., Zhou J., Zoghbi H., Zorilla S., Buck D., Reinhardt R., Poustka A., Rosenthal A., Lehrach H., Meindl A., Minx P.J., Hillier L.W., Willard H.F., Wilson R.K., Waterston R.H., Rice C.M., Vaudin M., Coulson A., Nelson D.L., Weinstock G., Sulston J.E., Durbin R.M., Hubbard T., Gibbs R.A., Beck S., Rogers J., Bentley D.R.
    Nature 434:325-337(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).

Entry informationi

Entry nameiFAM9B_HUMAN
AccessioniPrimary (citable) accession number: Q8IZU0
Secondary accession number(s): Q0IJ68, Q8N7Z8
Entry historyi
Integrated into UniProtKB/Swiss-Prot: March 25, 2003
Last sequence update: March 1, 2003
Last modified: May 11, 2016
This is version 94 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome X
    Human chromosome X: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.