Q8IZS5 (OFCC1_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 57.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Orofacial cleft 1 candidate gene 1 protein Alternative name(s): Orofacial clefting chromosomal breakpoint region candidate 1 protein | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 231 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Involvement in disease | Note=A chromosomal aberration involving OFCC1 is found in patients with orofacial cleft. |
Ontologies
| Keywords | |
|---|---|
| Coding sequence diversity | Alternative splicing Chromosomal rearrangement Polymorphism |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| None. [Check GOA] | |
Alternative products
| This entry describes 5 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q8IZS5-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q8IZS5-2) The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MWITSLITMKDEDIFDLAGDPQDSLIPGPSPTPKQNPVCNEAFFGHQTFSLRETGLKSVHCQGQEAENM 115-137: Missing. | ||||||
| Isoform 3 (identifier: Q8IZS5-3) The sequence of this isoform differs from the canonical sequence as follows: 115-231: DDDRIFYNRL...SRRYYREQRF → GSIPKKIGPC...EELEEHRFSV | ||||||
| Isoform 4 (identifier: Q8IZS5-4) The sequence of this isoform differs from the canonical sequence as follows: 115-231: DDDRIFYNRL...SRRYYREQRF → AF | ||||||
| Isoform 5 (identifier: Q8IZS5-5) The sequence of this isoform differs from the canonical sequence as follows: 115-231: DDDRIFYNRL...SRRYYREQRF → GFEIRRGRPQRIHSYVTFKDW |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 231 | 231 | Orofacial cleft 1 candidate gene 1 protein | PRO_0000337138 | |||||
Natural variations | |||||||||
| Alternative sequence | 1 | 1 | M → MWITSLITMKDEDIFDLAGD PQDSLIPGPSPTPKQNPVCN EAFFGHQTFSLRETGLKSVH CQGQEAENM in isoform 2. | VSP_033937 | |||||
| Alternative sequence | 115 – 231 | 117 | DDDRI…REQRF → GSIPKKIGPCSMDYDPNLLE EDDELHSQGDSLTDHSVKGK STVWRIGEAEDYSQDISYLE ELEEHRFSV in isoform 3. | VSP_033938 | |||||
| Alternative sequence | 115 – 231 | 117 | DDDRI…REQRF → AF in isoform 4. | VSP_033939 | |||||
| Alternative sequence | 115 – 231 | 117 | DDDRI…REQRF → GFEIRRGRPQRIHSYVTFKD W in isoform 5. | VSP_033940 | |||||
| Alternative sequence | 115 – 137 | 23 | Missing in isoform 2. | VSP_033941 | |||||
| Natural variant | 21 | 1 | S → L. Corresponds to variant rs9477310 [ dbSNP | Ensembl ]. | VAR_043621 | |||||
| Natural variant | 123 | 1 | R → Q. Corresponds to variant rs9383206 [ dbSNP | Ensembl ]. | VAR_043622 | |||||
| Natural variant | 145 | 1 | T → I. Corresponds to variant rs9477211 [ dbSNP | Ensembl ]. | VAR_043623 | |||||
Experimental info | |||||||||
| Sequence conflict | 178 | 1 | S → SP in AAN06680. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Molecular cloning, sequencing, and characterization of a novel 500 kilobase gene (MRDS1) from 6p24, a Schizophrenia candidate region." Matsumoto M., Weinberger D.R., Straub R.E. Submitted (JUN-2002) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 3), NUCLEOTIDE SEQUENCE [MRNA] OF 12-231 (ISOFORM 4), NUCLEOTIDE SEQUENCE [MRNA] OF 14-231 (ISOFORM 5). Tissue: Brain, Hippocampus and Placenta. |
| [2] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [3] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). |
| [4] | "Mapping of three translocation breakpoints associated with orofacial clefting within 6p24 and identification of new transcripts within the region." Davies S.J., Wise C., Venkatesh B., Mirza G., Jefferson A., Volpi E.V., Ragoussis J. Cytogenet. Genome Res. 105:47-53(2004) [PubMed: 15218257] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-162 (ISOFORMS 1 AND 2), CHROMOSOMAL REARRANGEMENT. Tissue: Placenta. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF520800 mRNA. Translation: AAN06675.1. AF520803 mRNA. Translation: AAN06678.1. AF520805 mRNA. Translation: AAN06680.1. AF520806 mRNA. Translation: AAN06681.1. AF520808 mRNA. Translation: AAN06683.1. CH471087 Genomic DNA. Translation: EAW55244.1. BC113541 mRNA. Translation: AAI13542.1. BC113543 mRNA. Translation: AAI13544.1. AF548113 mRNA. Translation: AAN59915.1. AY309094 mRNA. Translation: AAP74970.1. |
| IPI | IPI00186621. IPI00218059. IPI00333208. IPI00478152. IPI00893262. |
| UniGene | Hs.532138. |
3D structure databases | |
| ProteinModelPortal | Q8IZS5. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | Q8IZS5. |
Polymorphism databases | |
| DMDM | 74750797. |
Proteomic databases | |
| PRIDE | Q8IZS5. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000331403; ENSP00000327601; ENSG00000181355. |
| UCSC | uc003myj.1. human. uc003myn.1. human. uc010joi.1. human. |
Organism-specific databases | |
| GeneCards | GC06M009596. |
| H-InvDB | HIX0032805. |
| HGNC | HGNC:21017. OFCC1. |
| HPA | HPA035725. |
| MIM | 614287. gene. |
| neXtProt | NX_Q8IZS5. |
| GenAtlas | Search... |
Phylogenomic databases | |
| GeneTree | ENSGT00390000004053. |
| HOVERGEN | HBG108211. |
Gene expression databases | |
| ArrayExpress | Q8IZS5. |
| Bgee | Q8IZS5. |
| CleanEx | HS_OFCC1. |
| Genevestigator | Q8IZS5. |
Family and domain databases | |
| ProtoNet | Search... |
Other | |
| NextBio | 93241. |
| SOURCE | Search... |
Entry information
| Entry name | OFCC1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q8IZS5 Secondary accession number(s): Q7Z2X5 Q8IZS3 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 6 Human chromosome 6: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |

Clusters with