Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q8IZQ8

- MYCD_HUMAN

UniProt

Q8IZQ8 - MYCD_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Myocardin

Gene

MYOCD

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Smooth muscle cells (SM) and cardiac muscle cells-specific transcriptional factor which uses the canonical single or multiple CArG boxes DNA sequence. Acts as a cofactor of serum response factor (SRF) with the potential to modulate SRF-target genes. Plays a crucial role in cardiogenesis and differentiation of the smooth muscle cell lineage (myogenesis) (By similarity).By similarity

GO - Molecular functioni

  1. core promoter sequence-specific DNA binding Source: UniProtKB
  2. protein domain specific binding Source: UniProtKB
  3. RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in positive regulation of transcription Source: MGI
  4. RNA polymerase II transcription factor binding transcription factor activity Source: BHF-UCL
  5. transcription coactivator activity Source: Ensembl
  6. transcription factor binding Source: UniProtKB

GO - Biological processi

  1. cardiac muscle cell differentiation Source: BHF-UCL
  2. cardiac ventricle development Source: Ensembl
  3. cardiocyte differentiation Source: UniProtKB
  4. cell growth involved in cardiac muscle cell development Source: Ensembl
  5. cellular component maintenance Source: Ensembl
  6. cellular response to growth factor stimulus Source: Ensembl
  7. cellular response to hypoxia Source: Ensembl
  8. digestive tract development Source: Ensembl
  9. ductus arteriosus closure Source: Ensembl
  10. hepatic stellate cell activation Source: Ensembl
  11. lung alveolus development Source: Ensembl
  12. negative regulation of beta-amyloid clearance Source: BHF-UCL
  13. negative regulation of cardiac muscle cell apoptotic process Source: Ensembl
  14. negative regulation of cell proliferation Source: BHF-UCL
  15. negative regulation of cyclin-dependent protein serine/threonine kinase activity Source: BHF-UCL
  16. negative regulation of myotube differentiation Source: Ensembl
  17. negative regulation of skeletal muscle cell differentiation Source: BHF-UCL
  18. negative regulation of transcription from RNA polymerase II promoter Source: Ensembl
  19. positive regulation of cardiac muscle cell differentiation Source: BHF-UCL
  20. positive regulation of cardiac vascular smooth muscle cell differentiation Source: BHF-UCL
  21. positive regulation of cell proliferation Source: Ensembl
  22. positive regulation of DNA binding Source: Ensembl
  23. positive regulation of sequence-specific DNA binding transcription factor activity Source: BHF-UCL
  24. positive regulation of smooth muscle cell differentiation Source: BHF-UCL
  25. positive regulation of smooth muscle contraction Source: BHF-UCL
  26. positive regulation of transcription, DNA-templated Source: UniProtKB
  27. positive regulation of transcription from RNA polymerase II promoter Source: BHF-UCL
  28. positive regulation of transcription from RNA polymerase II promoter involved in myocardial precursor cell differentiation Source: BHF-UCL
  29. positive regulation of transcription from RNA polymerase II promoter involved in smooth muscle cell differentiation Source: BHF-UCL
  30. positive regulation of transforming growth factor beta receptor signaling pathway Source: Ensembl
  31. regulation of cell growth by extracellular stimulus Source: Ensembl
  32. regulation of histone acetylation Source: UniProtKB
  33. regulation of myoblast differentiation Source: Ensembl
  34. regulation of smooth muscle cell differentiation Source: BHF-UCL
  35. response to hypoxia Source: BHF-UCL
  36. smooth muscle cell differentiation Source: BHF-UCL
  37. urinary bladder development Source: Ensembl
  38. uterus development Source: Ensembl
  39. vasculogenesis Source: Ensembl
  40. ventricular cardiac muscle cell differentiation Source: Ensembl
Complete GO annotation...

Keywords - Molecular functioni

Activator

Keywords - Biological processi

Transcription, Transcription regulation

Names & Taxonomyi

Protein namesi
Recommended name:
Myocardin
Gene namesi
Name:MYOCD
Synonyms:MYCD
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 17

Organism-specific databases

HGNCiHGNC:16067. MYOCD.

Subcellular locationi

Nucleus By similarity

GO - Cellular componenti

  1. nucleus Source: BHF-UCL
Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134946896.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 938938MyocardinPRO_0000126631Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei451 – 4511Phosphoserine; by GSK3-betaBy similarity
Modified residuei455 – 4551Phosphoserine; by GSK3-betaBy similarity
Modified residuei459 – 4591Phosphoserine; by GSK3-betaBy similarity
Modified residuei463 – 4631Phosphoserine; by GSK3-betaBy similarity
Modified residuei626 – 6261Phosphoserine; by GSK3-betaBy similarity
Modified residuei630 – 6301Phosphoserine; by GSK3-betaBy similarity
Modified residuei634 – 6341Phosphoserine; by GSK3-betaBy similarity
Modified residuei638 – 6381Phosphoserine; by GSK3-betaBy similarity
Modified residuei815 – 8151Phosphoserine; by MAPK1 AND MAPK3By similarity
Modified residuei862 – 8621Phosphoserine; by MAPK1 and MAPK3By similarity
Modified residuei869 – 8691Phosphoserine; by MAPK1 and MAPK3By similarity
Modified residuei896 – 8961Phosphothreonine; by MAPK1 and MAPK3By similarity

Post-translational modificationi

Phosphorylation regulates negatively the intrinsic myocardin transcriptional activity.By similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ8IZQ8.
PaxDbiQ8IZQ8.
PRIDEiQ8IZQ8.

PTM databases

PhosphoSiteiQ8IZQ8.

Expressioni

Tissue specificityi

Expressed in heart, aorta, and in smooth muscle cell-containing tissues: stomach, bladder, small intestine, colon, lung, placenta and uterus. Very faint expression in prostate and skeletal muscle.2 Publications

Inductioni

Up-regulated during heart failure.1 Publication

Gene expression databases

BgeeiQ8IZQ8.
CleanExiHS_MYOCD.
ExpressionAtlasiQ8IZQ8. baseline and differential.
GenevestigatoriQ8IZQ8.

Organism-specific databases

HPAiCAB046485.

Interactioni

Subunit structurei

Homodimer. Interacts with SRF, its association does not depend on specific DNA sequences for ternary complex formation (By similarity). Interacts with MLLT7/FOXO4. Interacts (via C-terminal) with EP300 (via the CREB-binding domain). Interacts with HDAC4 and HDAC5 (By similarity). Interacts with MEF2C (By similarity).By similarity

Binary interactionsi

WithEntry#Exp.IntActNotes
SRFP118312EBI-493384,EBI-493034

Protein-protein interaction databases

BioGridi125044. 14 interactions.
IntActiQ8IZQ8. 2 interactions.
STRINGi9606.ENSP00000341835.

Structurei

3D structure databases

ProteinModelPortaliQ8IZQ8.
SMRiQ8IZQ8. Positions 14-129, 363-413.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Repeati18 – 4326RPEL 1Add
BLAST
Repeati62 – 8726RPEL 2Add
BLAST
Repeati106 – 13126RPEL 3Add
BLAST
Domaini371 – 40535SAPPROSITE-ProRule annotationAdd
BLAST

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni153 – 20553HDAC5-bindingBy similarityAdd
BLAST

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili516 – 56146Sequence AnalysisAdd
BLAST

Motif

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Motifi12 – 2716MEF2C-bindingBy similarityAdd
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi291 – 32232Gln-richAdd
BLAST
Compositional biasi435 – 50874Ser-richAdd
BLAST

Domaini

The C-terminal region contains a general transcription activation domain. The N-terminal region, comprising a basic and a Gln-rich domain, confers transcriptional potency and specificity by mediating association with the MADS box of SRF. The basic domain may be required for nuclear localization. The SAP domain is important for transactivation and ternary complex formation (By similarity).By similarity

Sequence similaritiesi

Contains 3 RPEL repeats.PROSITE-ProRule annotation
Contains 1 SAP domain.PROSITE-ProRule annotation

Keywords - Domaini

Coiled coil, Repeat

Phylogenomic databases

eggNOGiNOG79803.
GeneTreeiENSGT00530000063195.
HOGENOMiHOG000038001.
HOVERGENiHBG036493.
InParanoidiQ8IZQ8.
OMAiSFTESPW.
OrthoDBiEOG7VMP4N.
PhylomeDBiQ8IZQ8.
TreeFamiTF326024.

Family and domain databases

Gene3Di1.10.720.30. 1 hit.
InterProiIPR028721. MYOCD.
IPR004018. RPEL_repeat.
IPR003034. SAP_dom.
[Graphical view]
PANTHERiPTHR22793:SF11. PTHR22793:SF11. 1 hit.
PfamiPF02755. RPEL. 1 hit.
PF02037. SAP. 1 hit.
[Graphical view]
SMARTiSM00707. RPEL. 3 hits.
SM00513. SAP. 1 hit.
[Graphical view]
PROSITEiPS51073. RPEL. 3 hits.
PS50800. SAP. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q8IZQ8-1) [UniParc]FASTAAdd to Basket

Also known as: Myocardin-A

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MTLLGSEHSL LIRSKFRSVL QLRLQQRRTQ EQLANQGIIP PLKRPAEFHE
60 70 80 90 100
QRKHLDSDKA KNSLKRKARN RCNSADLVNM HILQASTAER SIPTAQMKLK
110 120 130 140 150
RARLADDLNE KIALRPGPLE LVEKNILPVD SAVKEAIKGN QVSFSKSTDA
160 170 180 190 200
FAFEEDSSSD GLSPDQTRSE DPQNSAGSPP DAKASDTPST GSLGTNQDLA
210 220 230 240 250
SGSENDRNDS ASQPSHQSDA GKQGLGPPST PIAVHAAVKS KSLGDSKNRH
260 270 280 290 300
KKPKDPKPKV KKLKYHQYIP PDQKAEKSPP PMDSAYARLL QQQQLFLQLQ
310 320 330 340 350
ILSQQQQQQQ HRFSYLGMHQ AQLKEPNEQM VRNPNSSSTP LSNTPLSPVK
360 370 380 390 400
NSFSGQTGVS SFKPGPLPPN LDDLKVSELR QQLRIRGLPV SGTKTALMDR
410 420 430 440 450
LRPFQDCSGN PVPNFGDITT VTFPVTPNTL PNYQSSSSTS ALSNGFYHFG
460 470 480 490 500
STSSSPPISP ASSDLSVAGS LPDTFNDASP SFGLHPSPVH VCTEESLMSS
510 520 530 540 550
LNGGSVPSEL DGLDSEKDKM LVEKQKVINE LTWKLQQEQR QVEELRMQLQ
560 570 580 590 600
KQKRNNCSEK KPLPFLAASI KQEEAVSSCP FASQVPVKRQ SSSSECHPPA
610 620 630 640 650
CEAAQLQPLG NAHCVESSDQ TNVLSSTFLS PQCSPQHSPL GAVKSPQHIS
660 670 680 690 700
LPPSPNNPHF LPSSSGAQGE GHRVSSPISS QVCTAQMAGL HSSDKVGPKF
710 720 730 740 750
SIPSPTFSKS SSAISEVTQP PSYEDAVKQQ MTRSQQMDEL LDVLIESGEM
760 770 780 790 800
PADAREDHSC LQKVPKIPRS SRSPTAVLTK PSASFEQASS GSQIPFDPYA
810 820 830 840 850
TDSDEHLEVL LNSQSPLGKM SDVTLLKIGS EEPHFDGIMD GFSGKAAEDL
860 870 880 890 900
FNAHEILPGP LSPMQTQFSP SSVDSNGLQL SFTESPWETM EWLDLTPPNS
910 920 930
TPGFSALTTS SPSIFNIDFL DVTDLNLNSS MDLHLQQW
Length:938
Mass (Da):101,997
Last modified:March 1, 2003 - v1
Checksum:i295F66A02725B0A5
GO
Isoform 2 (identifier: Q8IZQ8-2) [UniParc]FASTAAdd to Basket

Also known as: Myocardin-C

The sequence of this isoform differs from the canonical sequence as follows:
     1-96: Missing.
     686-686: Q → QNSGAHDGHPPSFSPHSSSLHPPFSGAQADSSHGAGGNPCPKSPCVQQK
     730-732: QMT → VTM
     733-938: Missing.

Note: No experimental confirmation available.

Show »
Length:684
Mass (Da):73,183
Checksum:i78D7F120161A7626
GO
Isoform 3 (identifier: Q8IZQ8-3) [UniParc]FASTAAdd to Basket

Also known as: Myocardin-B

The sequence of this isoform differs from the canonical sequence as follows:
     686-686: Q → QNSGAHDGHPPSFSPHSSSLHPPFSGAQADSSHGAGGNPCPKSPCVQQK

Show »
Length:986
Mass (Da):106,769
Checksum:i4FF5FCD468EEB86F
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 9696Missing in isoform 2. 1 PublicationVSP_007658Add
BLAST
Alternative sequencei686 – 6861Q → QNSGAHDGHPPSFSPHSSSL HPPFSGAQADSSHGAGGNPC PKSPCVQQK in isoform 2 and isoform 3. 4 PublicationsVSP_007659
Alternative sequencei730 – 7323QMT → VTM in isoform 2. 1 PublicationVSP_007660
Alternative sequencei733 – 938206Missing in isoform 2. 1 PublicationVSP_007661Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF532596 mRNA. Translation: AAN33040.1.
AY764180 mRNA. Translation: AAV33439.1.
AK292885 mRNA. Translation: BAF85574.1.
AK097821 mRNA. Translation: BAC05177.1.
AC005358 Genomic DNA. No translation available.
BC126307 mRNA. Translation: AAI26308.1.
BC143391 mRNA. Translation: AAI43392.1.
CCDSiCCDS11163.1. [Q8IZQ8-1]
CCDS54091.1. [Q8IZQ8-3]
RefSeqiNP_001139784.1. NM_001146312.2. [Q8IZQ8-3]
NP_705832.1. NM_153604.3. [Q8IZQ8-1]
UniGeneiHs.462257.
Hs.567641.

Genome annotation databases

EnsembliENST00000343344; ENSP00000341835; ENSG00000141052. [Q8IZQ8-1]
ENST00000425538; ENSP00000401678; ENSG00000141052. [Q8IZQ8-3]
GeneIDi93649.
KEGGihsa:93649.
UCSCiuc002gnn.2. human. [Q8IZQ8-1]
uc002gno.2. human. [Q8IZQ8-3]
uc002gnp.1. human. [Q8IZQ8-2]

Polymorphism databases

DMDMi32363335.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF532596 mRNA. Translation: AAN33040.1 .
AY764180 mRNA. Translation: AAV33439.1 .
AK292885 mRNA. Translation: BAF85574.1 .
AK097821 mRNA. Translation: BAC05177.1 .
AC005358 Genomic DNA. No translation available.
BC126307 mRNA. Translation: AAI26308.1 .
BC143391 mRNA. Translation: AAI43392.1 .
CCDSi CCDS11163.1. [Q8IZQ8-1 ]
CCDS54091.1. [Q8IZQ8-3 ]
RefSeqi NP_001139784.1. NM_001146312.2. [Q8IZQ8-3 ]
NP_705832.1. NM_153604.3. [Q8IZQ8-1 ]
UniGenei Hs.462257.
Hs.567641.

3D structure databases

ProteinModelPortali Q8IZQ8.
SMRi Q8IZQ8. Positions 14-129, 363-413.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 125044. 14 interactions.
IntActi Q8IZQ8. 2 interactions.
STRINGi 9606.ENSP00000341835.

PTM databases

PhosphoSitei Q8IZQ8.

Polymorphism databases

DMDMi 32363335.

Proteomic databases

MaxQBi Q8IZQ8.
PaxDbi Q8IZQ8.
PRIDEi Q8IZQ8.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000343344 ; ENSP00000341835 ; ENSG00000141052 . [Q8IZQ8-1 ]
ENST00000425538 ; ENSP00000401678 ; ENSG00000141052 . [Q8IZQ8-3 ]
GeneIDi 93649.
KEGGi hsa:93649.
UCSCi uc002gnn.2. human. [Q8IZQ8-1 ]
uc002gno.2. human. [Q8IZQ8-3 ]
uc002gnp.1. human. [Q8IZQ8-2 ]

Organism-specific databases

CTDi 93649.
GeneCardsi GC17P012569.
H-InvDB HIX0027347.
HGNCi HGNC:16067. MYOCD.
HPAi CAB046485.
MIMi 606127. gene.
neXtProti NX_Q8IZQ8.
PharmGKBi PA134946896.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG79803.
GeneTreei ENSGT00530000063195.
HOGENOMi HOG000038001.
HOVERGENi HBG036493.
InParanoidi Q8IZQ8.
OMAi SFTESPW.
OrthoDBi EOG7VMP4N.
PhylomeDBi Q8IZQ8.
TreeFami TF326024.

Miscellaneous databases

GeneWikii MYOCD.
GenomeRNAii 93649.
NextBioi 78180.
PROi Q8IZQ8.
SOURCEi Search...

Gene expression databases

Bgeei Q8IZQ8.
CleanExi HS_MYOCD.
ExpressionAtlasi Q8IZQ8. baseline and differential.
Genevestigatori Q8IZQ8.

Family and domain databases

Gene3Di 1.10.720.30. 1 hit.
InterProi IPR028721. MYOCD.
IPR004018. RPEL_repeat.
IPR003034. SAP_dom.
[Graphical view ]
PANTHERi PTHR22793:SF11. PTHR22793:SF11. 1 hit.
Pfami PF02755. RPEL. 1 hit.
PF02037. SAP. 1 hit.
[Graphical view ]
SMARTi SM00707. RPEL. 3 hits.
SM00513. SAP. 1 hit.
[Graphical view ]
PROSITEi PS51073. RPEL. 3 hits.
PS50800. SAP. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Potentiation of serum response factor activity by a family of myocardin-related transcription factors."
    Wang D.-Z., Li S., Hockemeyer D., Sutherland L., Wang Z., Schratt G., Richardson J.A., Nordheim A., Olson E.N.
    Proc. Natl. Acad. Sci. U.S.A. 99:14855-14860(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
  2. "Myocardin is a critical serum response factor cofactor in the transcriptional program regulating smooth muscle cell differentiation."
    Du K.L., Ip H.S., Li J., Chen M., Dandre F., Yu W., Lu M.M., Owens G.K., Parmacek M.S.
    Mol. Cell. Biol. 23:2425-2437(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), FUNCTION, TISSUE SPECIFICITY.
    Tissue: Heart.
  3. "Activation of cardiac and smooth muscle-specific genes in primary human cells after forced expression of human myocardin."
    van Tuyn J., Knaan-Shanzer S., van de Watering M.J., de Graaf M., van der Laarse A., Schalij M.J., van der Wall E.E., de Vries A.A., Atsma D.E.
    Cardiovasc. Res. 67:245-255(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3).
  4. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3).
    Tissue: Testis.
  5. "DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage."
    Zody M.C., Garber M., Adams D.J., Sharpe T., Harrow J., Lupski J.R., Nicholson C., Searle S.M., Wilming L., Young S.K., Abouelleil A., Allen N.R., Bi W., Bloom T., Borowsky M.L., Bugalter B.E., Butler J., Chang J.L.
    , Chen C.-K., Cook A., Corum B., Cuomo C.A., de Jong P.J., DeCaprio D., Dewar K., FitzGerald M., Gilbert J., Gibson R., Gnerre S., Goldstein S., Grafham D.V., Grocock R., Hafez N., Hagopian D.S., Hart E., Norman C.H., Humphray S., Jaffe D.B., Jones M., Kamal M., Khodiyar V.K., LaButti K., Laird G., Lehoczky J., Liu X., Lokyitsang T., Loveland J., Lui A., Macdonald P., Major J.E., Matthews L., Mauceli E., McCarroll S.A., Mihalev A.H., Mudge J., Nguyen C., Nicol R., O'Leary S.B., Osoegawa K., Schwartz D.C., Shaw-Smith C., Stankiewicz P., Steward C., Swarbreck D., Venkataraman V., Whittaker C.A., Yang X., Zimmer A.R., Bradley A., Hubbard T., Birren B.W., Rogers J., Lander E.S., Nusbaum C.
    Nature 440:1045-1049(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
  7. "Myocardin mRNA is augmented in the failing myocardium: expression profiling in the porcine model and human dilated cardiomyopathy."
    Torrado M., Lopez E., Centeno A., Medrano C., Castro-Beiras A., Mikhailov A.T.
    J. Mol. Med. 81:566-577(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: ALTERNATIVE SPLICING (ISOFORMS 1; 2 AND 3), INDUCTION.
  8. "Phenotypic modulation of smooth muscle cells through interaction of Foxo4 and myocardin."
    Liu Z.-P., Wang Z., Yanagisawa H., Olson E.N.
    Dev. Cell 9:261-270(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH MLLT7.
  9. "Expression and functional activity of four myocardin isoforms."
    Imamura M., Long X., Nanda V., Miano J.M.
    Gene 464:1-10(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: TISSUE SPECIFICITY OF ISOFORMS.

Entry informationi

Entry nameiMYCD_HUMAN
AccessioniPrimary (citable) accession number: Q8IZQ8
Secondary accession number(s): Q5UBU5, Q8N7Q1
Entry historyi
Integrated into UniProtKB/Swiss-Prot: June 27, 2003
Last sequence update: March 1, 2003
Last modified: October 29, 2014
This is version 114 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3