Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q8IZQ8 (MYCD_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 111. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (3) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Myocardin
Gene names
Name:MYOCD
Synonyms:MYCD
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length938 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Smooth muscle cells (SM) and cardiac muscle cells-specific transcriptional factor which uses the canonical single or multiple CArG boxes DNA sequence. Acts as a cofactor of serum response factor (SRF) with the potential to modulate SRF-target genes. Plays a crucial role in cardiogenesis and differentiation of the smooth muscle cell lineage (myogenesis) By similarity. Ref.2

Subunit structure

Homodimer. Interacts with SRF, its association does not depend on specific DNA sequences for ternary complex formation By similarity. Interacts with MLLT7/FOXO4. Interacts (via C-terminal) with EP300 (via the CREB-binding domain). Interacts with HDAC4 and HDAC5 By similarity. Interacts with MEF2C By similarity. Ref.8

Subcellular location

Nucleus By similarity.

Tissue specificity

Expressed in heart, aorta, and in smooth muscle cell-containing tissues: stomach, bladder, small intestine, colon, lung, placenta and uterus. Very faint expression in prostate and skeletal muscle. Ref.2 Ref.9

Induction

Up-regulated during heart failure. Ref.7

Domain

The C-terminal region contains a general transcription activation domain. The N-terminal region, comprising a basic and a Gln-rich domain, confers transcriptional potency and specificity by mediating association with the MADS box of SRF. The basic domain may be required for nuclear localization. The SAP domain is important for transactivation and ternary complex formation By similarity.

Post-translational modification

Phosphorylation regulates negatively the intrinsic myocardin transcriptional activity By similarity.

Sequence similarities

Contains 3 RPEL repeats.

Contains 1 SAP domain.

Ontologies

Keywords
   Biological processTranscription
Transcription regulation
   Cellular componentNucleus
   Coding sequence diversityAlternative splicing
   DomainCoiled coil
Repeat
   Molecular functionActivator
   PTMPhosphoprotein
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Biological_processcardiac muscle cell differentiation

Inferred from sequence or structural similarity. Source: BHF-UCL

cardiocyte differentiation

Non-traceable author statement Ref.2. Source: UniProtKB

negative regulation of beta-amyloid clearance

Inferred from mutant phenotype PubMed 19098903. Source: BHF-UCL

negative regulation of cell proliferation

Inferred from direct assay PubMed 18451334. Source: BHF-UCL

negative regulation of cyclin-dependent protein serine/threonine kinase activity

Inferred from direct assay PubMed 18451334. Source: BHF-UCL

negative regulation of skeletal muscle cell differentiation

Inferred from direct assay PubMed 18451334. Source: BHF-UCL

positive regulation of cardiac muscle cell differentiation

Inferred from direct assay PubMed 18451334. Source: BHF-UCL

positive regulation of cardiac vascular smooth muscle cell differentiation

Inferred from sequence or structural similarity. Source: BHF-UCL

positive regulation of sequence-specific DNA binding transcription factor activity

Inferred from direct assay PubMed 19098903. Source: BHF-UCL

positive regulation of smooth muscle cell differentiation

Inferred from direct assay PubMed 18451334. Source: BHF-UCL

positive regulation of smooth muscle contraction

Inferred from direct assay PubMed 17215356. Source: BHF-UCL

positive regulation of transcription from RNA polymerase II promoter

Inferred from direct assay PubMed 14970199PubMed 17215356. Source: BHF-UCL

positive regulation of transcription from RNA polymerase II promoter involved in myocardial precursor cell differentiation

Inferred from direct assay Ref.3. Source: BHF-UCL

positive regulation of transcription from RNA polymerase II promoter involved in smooth muscle cell differentiation

Inferred from direct assay Ref.3. Source: BHF-UCL

positive regulation of transcription, DNA-templated

Inferred from direct assay PubMed 19797053. Source: UniProtKB

regulation of histone acetylation

Inferred from sequence or structural similarity. Source: UniProtKB

regulation of smooth muscle cell differentiation

Traceable author statement PubMed 17215356. Source: BHF-UCL

response to hypoxia

Inferred from expression pattern PubMed 19098903. Source: BHF-UCL

smooth muscle cell differentiation

Inferred from mutant phenotype PubMed 14970199. Source: BHF-UCL

transcription from RNA polymerase II promoter

Inferred from sequence or structural similarity. Source: GOC

   Cellular_componentnucleus

Inferred from direct assay PubMed 14970199. Source: BHF-UCL

   Molecular_functionRNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in positive regulation of transcription

Inferred from direct assay PubMed 22157009. Source: MGI

RNA polymerase II transcription factor binding transcription factor activity

Inferred from sequence or structural similarity. Source: BHF-UCL

core promoter sequence-specific DNA binding

Inferred from direct assay PubMed 19797053. Source: UniProtKB

protein binding

Inferred from physical interaction PubMed 19797053. Source: UniProtKB

protein domain specific binding

Inferred from direct assay PubMed 19797053. Source: UniProtKB

transcription factor binding

Inferred from physical interaction Ref.8. Source: UniProtKB

Complete GO annotation...

Binary interactions

With

Entry

#Exp.

IntAct

Notes

SRFP118312EBI-493384,EBI-493034

Alternative products

This entry describes 3 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q8IZQ8-1)

Also known as: Myocardin-A;

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q8IZQ8-2)

Also known as: Myocardin-C;

The sequence of this isoform differs from the canonical sequence as follows:
     1-96: Missing.
     686-686: Q → QNSGAHDGHPPSFSPHSSSLHPPFSGAQADSSHGAGGNPCPKSPCVQQK
     730-732: QMT → VTM
     733-938: Missing.
Note: No experimental confirmation available.
Isoform 3 (identifier: Q8IZQ8-3)

Also known as: Myocardin-B;

The sequence of this isoform differs from the canonical sequence as follows:
     686-686: Q → QNSGAHDGHPPSFSPHSSSLHPPFSGAQADSSHGAGGNPCPKSPCVQQK

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 938938Myocardin
PRO_0000126631

Regions

Repeat18 – 4326RPEL 1
Repeat62 – 8726RPEL 2
Repeat106 – 13126RPEL 3
Domain371 – 40535SAP
Region153 – 20553HDAC5-binding By similarity
Coiled coil516 – 56146 Potential
Motif12 – 2716MEF2C-binding By similarity
Compositional bias291 – 32232Gln-rich
Compositional bias435 – 50874Ser-rich

Amino acid modifications

Modified residue4511Phosphoserine; by GSK3-beta By similarity
Modified residue4551Phosphoserine; by GSK3-beta By similarity
Modified residue4591Phosphoserine; by GSK3-beta By similarity
Modified residue4631Phosphoserine; by GSK3-beta By similarity
Modified residue6261Phosphoserine; by GSK3-beta By similarity
Modified residue6301Phosphoserine; by GSK3-beta By similarity
Modified residue6341Phosphoserine; by GSK3-beta By similarity
Modified residue6381Phosphoserine; by GSK3-beta By similarity
Modified residue8151Phosphoserine; by MAPK1 AND MAPK3 By similarity
Modified residue8621Phosphoserine; by MAPK1 and MAPK3 By similarity
Modified residue8691Phosphoserine; by MAPK1 and MAPK3 By similarity
Modified residue8961Phosphothreonine; by MAPK1 and MAPK3 By similarity

Natural variations

Alternative sequence1 – 9696Missing in isoform 2.
VSP_007658
Alternative sequence6861Q → QNSGAHDGHPPSFSPHSSSL HPPFSGAQADSSHGAGGNPC PKSPCVQQK in isoform 2 and isoform 3.
VSP_007659
Alternative sequence730 – 7323QMT → VTM in isoform 2.
VSP_007660
Alternative sequence733 – 938206Missing in isoform 2.
VSP_007661

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 (Myocardin-A) [UniParc].

Last modified March 1, 2003. Version 1.
Checksum: 295F66A02725B0A5

FASTA938101,997
        10         20         30         40         50         60 
MTLLGSEHSL LIRSKFRSVL QLRLQQRRTQ EQLANQGIIP PLKRPAEFHE QRKHLDSDKA 

        70         80         90        100        110        120 
KNSLKRKARN RCNSADLVNM HILQASTAER SIPTAQMKLK RARLADDLNE KIALRPGPLE 

       130        140        150        160        170        180 
LVEKNILPVD SAVKEAIKGN QVSFSKSTDA FAFEEDSSSD GLSPDQTRSE DPQNSAGSPP 

       190        200        210        220        230        240 
DAKASDTPST GSLGTNQDLA SGSENDRNDS ASQPSHQSDA GKQGLGPPST PIAVHAAVKS 

       250        260        270        280        290        300 
KSLGDSKNRH KKPKDPKPKV KKLKYHQYIP PDQKAEKSPP PMDSAYARLL QQQQLFLQLQ 

       310        320        330        340        350        360 
ILSQQQQQQQ HRFSYLGMHQ AQLKEPNEQM VRNPNSSSTP LSNTPLSPVK NSFSGQTGVS 

       370        380        390        400        410        420 
SFKPGPLPPN LDDLKVSELR QQLRIRGLPV SGTKTALMDR LRPFQDCSGN PVPNFGDITT 

       430        440        450        460        470        480 
VTFPVTPNTL PNYQSSSSTS ALSNGFYHFG STSSSPPISP ASSDLSVAGS LPDTFNDASP 

       490        500        510        520        530        540 
SFGLHPSPVH VCTEESLMSS LNGGSVPSEL DGLDSEKDKM LVEKQKVINE LTWKLQQEQR 

       550        560        570        580        590        600 
QVEELRMQLQ KQKRNNCSEK KPLPFLAASI KQEEAVSSCP FASQVPVKRQ SSSSECHPPA 

       610        620        630        640        650        660 
CEAAQLQPLG NAHCVESSDQ TNVLSSTFLS PQCSPQHSPL GAVKSPQHIS LPPSPNNPHF 

       670        680        690        700        710        720 
LPSSSGAQGE GHRVSSPISS QVCTAQMAGL HSSDKVGPKF SIPSPTFSKS SSAISEVTQP 

       730        740        750        760        770        780 
PSYEDAVKQQ MTRSQQMDEL LDVLIESGEM PADAREDHSC LQKVPKIPRS SRSPTAVLTK 

       790        800        810        820        830        840 
PSASFEQASS GSQIPFDPYA TDSDEHLEVL LNSQSPLGKM SDVTLLKIGS EEPHFDGIMD 

       850        860        870        880        890        900 
GFSGKAAEDL FNAHEILPGP LSPMQTQFSP SSVDSNGLQL SFTESPWETM EWLDLTPPNS 

       910        920        930 
TPGFSALTTS SPSIFNIDFL DVTDLNLNSS MDLHLQQW 

« Hide

Isoform 2 (Myocardin-C) [UniParc].

Checksum: 78D7F120161A7626
Show »

FASTA68473,183
Isoform 3 (Myocardin-B) [UniParc].

Checksum: 4FF5FCD468EEB86F
Show »

FASTA986106,769

References

« Hide 'large scale' references
[1]"Potentiation of serum response factor activity by a family of myocardin-related transcription factors."
Wang D.-Z., Li S., Hockemeyer D., Sutherland L., Wang Z., Schratt G., Richardson J.A., Nordheim A., Olson E.N.
Proc. Natl. Acad. Sci. U.S.A. 99:14855-14860(2002) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
[2]"Myocardin is a critical serum response factor cofactor in the transcriptional program regulating smooth muscle cell differentiation."
Du K.L., Ip H.S., Li J., Chen M., Dandre F., Yu W., Lu M.M., Owens G.K., Parmacek M.S.
Mol. Cell. Biol. 23:2425-2437(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), FUNCTION, TISSUE SPECIFICITY.
Tissue: Heart.
[3]"Activation of cardiac and smooth muscle-specific genes in primary human cells after forced expression of human myocardin."
van Tuyn J., Knaan-Shanzer S., van de Watering M.J., de Graaf M., van der Laarse A., Schalij M.J., van der Wall E.E., de Vries A.A., Atsma D.E.
Cardiovasc. Res. 67:245-255(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3).
[4]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3).
Tissue: Testis.
[5]"DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage."
Zody M.C., Garber M., Adams D.J., Sharpe T., Harrow J., Lupski J.R., Nicholson C., Searle S.M., Wilming L., Young S.K., Abouelleil A., Allen N.R., Bi W., Bloom T., Borowsky M.L., Bugalter B.E., Butler J., Chang J.L. expand/collapse author list , Chen C.-K., Cook A., Corum B., Cuomo C.A., de Jong P.J., DeCaprio D., Dewar K., FitzGerald M., Gilbert J., Gibson R., Gnerre S., Goldstein S., Grafham D.V., Grocock R., Hafez N., Hagopian D.S., Hart E., Norman C.H., Humphray S., Jaffe D.B., Jones M., Kamal M., Khodiyar V.K., LaButti K., Laird G., Lehoczky J., Liu X., Lokyitsang T., Loveland J., Lui A., Macdonald P., Major J.E., Matthews L., Mauceli E., McCarroll S.A., Mihalev A.H., Mudge J., Nguyen C., Nicol R., O'Leary S.B., Osoegawa K., Schwartz D.C., Shaw-Smith C., Stankiewicz P., Steward C., Swarbreck D., Venkataraman V., Whittaker C.A., Yang X., Zimmer A.R., Bradley A., Hubbard T., Birren B.W., Rogers J., Lander E.S., Nusbaum C.
Nature 440:1045-1049(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[6]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
[7]"Myocardin mRNA is augmented in the failing myocardium: expression profiling in the porcine model and human dilated cardiomyopathy."
Torrado M., Lopez E., Centeno A., Medrano C., Castro-Beiras A., Mikhailov A.T.
J. Mol. Med. 81:566-577(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: ALTERNATIVE SPLICING (ISOFORMS 1; 2 AND 3), INDUCTION.
[8]"Phenotypic modulation of smooth muscle cells through interaction of Foxo4 and myocardin."
Liu Z.-P., Wang Z., Yanagisawa H., Olson E.N.
Dev. Cell 9:261-270(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: INTERACTION WITH MLLT7.
[9]"Expression and functional activity of four myocardin isoforms."
Imamura M., Long X., Nanda V., Miano J.M.
Gene 464:1-10(2010) [PubMed] [Europe PMC] [Abstract]
Cited for: TISSUE SPECIFICITY OF ISOFORMS.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AF532596 mRNA. Translation: AAN33040.1.
AY764180 mRNA. Translation: AAV33439.1.
AK292885 mRNA. Translation: BAF85574.1.
AK097821 mRNA. Translation: BAC05177.1.
AC005358 Genomic DNA. No translation available.
BC126307 mRNA. Translation: AAI26308.1.
BC143391 mRNA. Translation: AAI43392.1.
CCDSCCDS11163.1. [Q8IZQ8-1]
CCDS54091.1. [Q8IZQ8-3]
RefSeqNP_001139784.1. NM_001146312.2. [Q8IZQ8-3]
NP_705832.1. NM_153604.3. [Q8IZQ8-1]
UniGeneHs.462257.
Hs.567641.

3D structure databases

ProteinModelPortalQ8IZQ8.
SMRQ8IZQ8. Positions 14-129, 363-413.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid125044. 14 interactions.
IntActQ8IZQ8. 2 interactions.
STRING9606.ENSP00000341835.

PTM databases

PhosphoSiteQ8IZQ8.

Polymorphism databases

DMDM32363335.

Proteomic databases

MaxQBQ8IZQ8.
PaxDbQ8IZQ8.
PRIDEQ8IZQ8.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000343344; ENSP00000341835; ENSG00000141052. [Q8IZQ8-1]
ENST00000425538; ENSP00000401678; ENSG00000141052. [Q8IZQ8-3]
GeneID93649.
KEGGhsa:93649.
UCSCuc002gnn.2. human. [Q8IZQ8-1]
uc002gno.2. human. [Q8IZQ8-3]
uc002gnp.1. human. [Q8IZQ8-2]

Organism-specific databases

CTD93649.
GeneCardsGC17P012569.
H-InvDBHIX0027347.
HGNCHGNC:16067. MYOCD.
HPACAB046485.
MIM606127. gene.
neXtProtNX_Q8IZQ8.
PharmGKBPA134946896.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG79803.
HOGENOMHOG000038001.
HOVERGENHBG036493.
OMASFTESPW.
OrthoDBEOG7VMP4N.
PhylomeDBQ8IZQ8.
TreeFamTF326024.

Gene expression databases

ArrayExpressQ8IZQ8.
BgeeQ8IZQ8.
CleanExHS_MYOCD.
GenevestigatorQ8IZQ8.

Family and domain databases

Gene3D1.10.720.30. 1 hit.
InterProIPR028721. MYOCD.
IPR004018. RPEL_repeat.
IPR003034. SAP_dom.
[Graphical view]
PANTHERPTHR22793:SF11. PTHR22793:SF11. 1 hit.
PfamPF02755. RPEL. 1 hit.
PF02037. SAP. 1 hit.
[Graphical view]
SMARTSM00707. RPEL. 3 hits.
SM00513. SAP. 1 hit.
[Graphical view]
PROSITEPS51073. RPEL. 3 hits.
PS50800. SAP. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

GeneWikiMYOCD.
GenomeRNAi93649.
NextBio78180.
PROQ8IZQ8.
SOURCESearch...

Entry information

Entry nameMYCD_HUMAN
AccessionPrimary (citable) accession number: Q8IZQ8
Secondary accession number(s): Q5UBU5, Q8N7Q1
Entry history
Integrated into UniProtKB/Swiss-Prot: June 27, 2003
Last sequence update: March 1, 2003
Last modified: July 9, 2014
This is version 111 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human chromosome 17

Human chromosome 17: entries, gene names and cross-references to MIM