Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q8IZQ8

- MYCD_HUMAN

UniProt

Q8IZQ8 - MYCD_HUMAN

Protein

Myocardin

Gene

MYOCD

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 113 (01 Oct 2014)
      Sequence version 1 (01 Mar 2003)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Smooth muscle cells (SM) and cardiac muscle cells-specific transcriptional factor which uses the canonical single or multiple CArG boxes DNA sequence. Acts as a cofactor of serum response factor (SRF) with the potential to modulate SRF-target genes. Plays a crucial role in cardiogenesis and differentiation of the smooth muscle cell lineage (myogenesis) By similarity.By similarity

    GO - Molecular functioni

    1. core promoter sequence-specific DNA binding Source: UniProtKB
    2. protein binding Source: UniProtKB
    3. protein domain specific binding Source: UniProtKB
    4. RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in positive regulation of transcription Source: MGI
    5. RNA polymerase II transcription factor binding transcription factor activity Source: BHF-UCL
    6. transcription coactivator activity Source: InterPro
    7. transcription factor binding Source: UniProtKB

    GO - Biological processi

    1. cardiac muscle cell differentiation Source: BHF-UCL
    2. cardiocyte differentiation Source: UniProtKB
    3. negative regulation of beta-amyloid clearance Source: BHF-UCL
    4. negative regulation of cell proliferation Source: BHF-UCL
    5. negative regulation of cyclin-dependent protein serine/threonine kinase activity Source: BHF-UCL
    6. negative regulation of skeletal muscle cell differentiation Source: BHF-UCL
    7. positive regulation of cardiac muscle cell differentiation Source: BHF-UCL
    8. positive regulation of cardiac vascular smooth muscle cell differentiation Source: BHF-UCL
    9. positive regulation of sequence-specific DNA binding transcription factor activity Source: BHF-UCL
    10. positive regulation of smooth muscle cell differentiation Source: BHF-UCL
    11. positive regulation of smooth muscle contraction Source: BHF-UCL
    12. positive regulation of transcription, DNA-templated Source: UniProtKB
    13. positive regulation of transcription from RNA polymerase II promoter Source: BHF-UCL
    14. positive regulation of transcription from RNA polymerase II promoter involved in myocardial precursor cell differentiation Source: BHF-UCL
    15. positive regulation of transcription from RNA polymerase II promoter involved in smooth muscle cell differentiation Source: BHF-UCL
    16. regulation of histone acetylation Source: UniProtKB
    17. regulation of smooth muscle cell differentiation Source: BHF-UCL
    18. response to hypoxia Source: BHF-UCL
    19. smooth muscle cell differentiation Source: BHF-UCL
    20. transcription from RNA polymerase II promoter Source: GOC

    Keywords - Molecular functioni

    Activator

    Keywords - Biological processi

    Transcription, Transcription regulation

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Myocardin
    Gene namesi
    Name:MYOCD
    Synonyms:MYCD
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 17

    Organism-specific databases

    HGNCiHGNC:16067. MYOCD.

    Subcellular locationi

    Nucleus By similarity

    GO - Cellular componenti

    1. nucleus Source: BHF-UCL

    Keywords - Cellular componenti

    Nucleus

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA134946896.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 938938MyocardinPRO_0000126631Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei451 – 4511Phosphoserine; by GSK3-betaBy similarity
    Modified residuei455 – 4551Phosphoserine; by GSK3-betaBy similarity
    Modified residuei459 – 4591Phosphoserine; by GSK3-betaBy similarity
    Modified residuei463 – 4631Phosphoserine; by GSK3-betaBy similarity
    Modified residuei626 – 6261Phosphoserine; by GSK3-betaBy similarity
    Modified residuei630 – 6301Phosphoserine; by GSK3-betaBy similarity
    Modified residuei634 – 6341Phosphoserine; by GSK3-betaBy similarity
    Modified residuei638 – 6381Phosphoserine; by GSK3-betaBy similarity
    Modified residuei815 – 8151Phosphoserine; by MAPK1 AND MAPK3By similarity
    Modified residuei862 – 8621Phosphoserine; by MAPK1 and MAPK3By similarity
    Modified residuei869 – 8691Phosphoserine; by MAPK1 and MAPK3By similarity
    Modified residuei896 – 8961Phosphothreonine; by MAPK1 and MAPK3By similarity

    Post-translational modificationi

    Phosphorylation regulates negatively the intrinsic myocardin transcriptional activity.By similarity

    Keywords - PTMi

    Phosphoprotein

    Proteomic databases

    MaxQBiQ8IZQ8.
    PaxDbiQ8IZQ8.
    PRIDEiQ8IZQ8.

    PTM databases

    PhosphoSiteiQ8IZQ8.

    Expressioni

    Tissue specificityi

    Expressed in heart, aorta, and in smooth muscle cell-containing tissues: stomach, bladder, small intestine, colon, lung, placenta and uterus. Very faint expression in prostate and skeletal muscle.2 Publications

    Inductioni

    Up-regulated during heart failure.1 Publication

    Gene expression databases

    ArrayExpressiQ8IZQ8.
    BgeeiQ8IZQ8.
    CleanExiHS_MYOCD.
    GenevestigatoriQ8IZQ8.

    Organism-specific databases

    HPAiCAB046485.

    Interactioni

    Subunit structurei

    Homodimer. Interacts with SRF, its association does not depend on specific DNA sequences for ternary complex formation By similarity. Interacts with MLLT7/FOXO4. Interacts (via C-terminal) with EP300 (via the CREB-binding domain). Interacts with HDAC4 and HDAC5 By similarity. Interacts with MEF2C By similarity.By similarity

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    SRFP118312EBI-493384,EBI-493034

    Protein-protein interaction databases

    BioGridi125044. 14 interactions.
    IntActiQ8IZQ8. 2 interactions.
    STRINGi9606.ENSP00000341835.

    Structurei

    3D structure databases

    ProteinModelPortaliQ8IZQ8.
    SMRiQ8IZQ8. Positions 14-129, 363-413.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Repeati18 – 4326RPEL 1Add
    BLAST
    Repeati62 – 8726RPEL 2Add
    BLAST
    Repeati106 – 13126RPEL 3Add
    BLAST
    Domaini371 – 40535SAPPROSITE-ProRule annotationAdd
    BLAST

    Region

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Regioni153 – 20553HDAC5-bindingBy similarityAdd
    BLAST

    Coiled coil

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Coiled coili516 – 56146Sequence AnalysisAdd
    BLAST

    Motif

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Motifi12 – 2716MEF2C-bindingBy similarityAdd
    BLAST

    Compositional bias

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Compositional biasi291 – 32232Gln-richAdd
    BLAST
    Compositional biasi435 – 50874Ser-richAdd
    BLAST

    Domaini

    The C-terminal region contains a general transcription activation domain. The N-terminal region, comprising a basic and a Gln-rich domain, confers transcriptional potency and specificity by mediating association with the MADS box of SRF. The basic domain may be required for nuclear localization. The SAP domain is important for transactivation and ternary complex formation By similarity.By similarity

    Sequence similaritiesi

    Contains 3 RPEL repeats.PROSITE-ProRule annotation
    Contains 1 SAP domain.PROSITE-ProRule annotation

    Keywords - Domaini

    Coiled coil, Repeat

    Phylogenomic databases

    eggNOGiNOG79803.
    HOGENOMiHOG000038001.
    HOVERGENiHBG036493.
    OMAiSFTESPW.
    OrthoDBiEOG7VMP4N.
    PhylomeDBiQ8IZQ8.
    TreeFamiTF326024.

    Family and domain databases

    Gene3Di1.10.720.30. 1 hit.
    InterProiIPR028721. MYOCD.
    IPR004018. RPEL_repeat.
    IPR003034. SAP_dom.
    [Graphical view]
    PANTHERiPTHR22793:SF11. PTHR22793:SF11. 1 hit.
    PfamiPF02755. RPEL. 1 hit.
    PF02037. SAP. 1 hit.
    [Graphical view]
    SMARTiSM00707. RPEL. 3 hits.
    SM00513. SAP. 1 hit.
    [Graphical view]
    PROSITEiPS51073. RPEL. 3 hits.
    PS50800. SAP. 1 hit.
    [Graphical view]

    Sequences (3)i

    Sequence statusi: Complete.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q8IZQ8-1) [UniParc]FASTAAdd to Basket

    Also known as: Myocardin-A

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MTLLGSEHSL LIRSKFRSVL QLRLQQRRTQ EQLANQGIIP PLKRPAEFHE    50
    QRKHLDSDKA KNSLKRKARN RCNSADLVNM HILQASTAER SIPTAQMKLK 100
    RARLADDLNE KIALRPGPLE LVEKNILPVD SAVKEAIKGN QVSFSKSTDA 150
    FAFEEDSSSD GLSPDQTRSE DPQNSAGSPP DAKASDTPST GSLGTNQDLA 200
    SGSENDRNDS ASQPSHQSDA GKQGLGPPST PIAVHAAVKS KSLGDSKNRH 250
    KKPKDPKPKV KKLKYHQYIP PDQKAEKSPP PMDSAYARLL QQQQLFLQLQ 300
    ILSQQQQQQQ HRFSYLGMHQ AQLKEPNEQM VRNPNSSSTP LSNTPLSPVK 350
    NSFSGQTGVS SFKPGPLPPN LDDLKVSELR QQLRIRGLPV SGTKTALMDR 400
    LRPFQDCSGN PVPNFGDITT VTFPVTPNTL PNYQSSSSTS ALSNGFYHFG 450
    STSSSPPISP ASSDLSVAGS LPDTFNDASP SFGLHPSPVH VCTEESLMSS 500
    LNGGSVPSEL DGLDSEKDKM LVEKQKVINE LTWKLQQEQR QVEELRMQLQ 550
    KQKRNNCSEK KPLPFLAASI KQEEAVSSCP FASQVPVKRQ SSSSECHPPA 600
    CEAAQLQPLG NAHCVESSDQ TNVLSSTFLS PQCSPQHSPL GAVKSPQHIS 650
    LPPSPNNPHF LPSSSGAQGE GHRVSSPISS QVCTAQMAGL HSSDKVGPKF 700
    SIPSPTFSKS SSAISEVTQP PSYEDAVKQQ MTRSQQMDEL LDVLIESGEM 750
    PADAREDHSC LQKVPKIPRS SRSPTAVLTK PSASFEQASS GSQIPFDPYA 800
    TDSDEHLEVL LNSQSPLGKM SDVTLLKIGS EEPHFDGIMD GFSGKAAEDL 850
    FNAHEILPGP LSPMQTQFSP SSVDSNGLQL SFTESPWETM EWLDLTPPNS 900
    TPGFSALTTS SPSIFNIDFL DVTDLNLNSS MDLHLQQW 938
    Length:938
    Mass (Da):101,997
    Last modified:March 1, 2003 - v1
    Checksum:i295F66A02725B0A5
    GO
    Isoform 2 (identifier: Q8IZQ8-2) [UniParc]FASTAAdd to Basket

    Also known as: Myocardin-C

    The sequence of this isoform differs from the canonical sequence as follows:
         1-96: Missing.
         686-686: Q → QNSGAHDGHPPSFSPHSSSLHPPFSGAQADSSHGAGGNPCPKSPCVQQK
         730-732: QMT → VTM
         733-938: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:684
    Mass (Da):73,183
    Checksum:i78D7F120161A7626
    GO
    Isoform 3 (identifier: Q8IZQ8-3) [UniParc]FASTAAdd to Basket

    Also known as: Myocardin-B

    The sequence of this isoform differs from the canonical sequence as follows:
         686-686: Q → QNSGAHDGHPPSFSPHSSSLHPPFSGAQADSSHGAGGNPCPKSPCVQQK

    Show »
    Length:986
    Mass (Da):106,769
    Checksum:i4FF5FCD468EEB86F
    GO

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 9696Missing in isoform 2. 1 PublicationVSP_007658Add
    BLAST
    Alternative sequencei686 – 6861Q → QNSGAHDGHPPSFSPHSSSL HPPFSGAQADSSHGAGGNPC PKSPCVQQK in isoform 2 and isoform 3. 4 PublicationsVSP_007659
    Alternative sequencei730 – 7323QMT → VTM in isoform 2. 1 PublicationVSP_007660
    Alternative sequencei733 – 938206Missing in isoform 2. 1 PublicationVSP_007661Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF532596 mRNA. Translation: AAN33040.1.
    AY764180 mRNA. Translation: AAV33439.1.
    AK292885 mRNA. Translation: BAF85574.1.
    AK097821 mRNA. Translation: BAC05177.1.
    AC005358 Genomic DNA. No translation available.
    BC126307 mRNA. Translation: AAI26308.1.
    BC143391 mRNA. Translation: AAI43392.1.
    CCDSiCCDS11163.1. [Q8IZQ8-1]
    CCDS54091.1. [Q8IZQ8-3]
    RefSeqiNP_001139784.1. NM_001146312.2. [Q8IZQ8-3]
    NP_705832.1. NM_153604.3. [Q8IZQ8-1]
    UniGeneiHs.462257.
    Hs.567641.

    Genome annotation databases

    EnsembliENST00000343344; ENSP00000341835; ENSG00000141052. [Q8IZQ8-1]
    ENST00000425538; ENSP00000401678; ENSG00000141052. [Q8IZQ8-3]
    GeneIDi93649.
    KEGGihsa:93649.
    UCSCiuc002gnn.2. human. [Q8IZQ8-1]
    uc002gno.2. human. [Q8IZQ8-3]
    uc002gnp.1. human. [Q8IZQ8-2]

    Polymorphism databases

    DMDMi32363335.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF532596 mRNA. Translation: AAN33040.1 .
    AY764180 mRNA. Translation: AAV33439.1 .
    AK292885 mRNA. Translation: BAF85574.1 .
    AK097821 mRNA. Translation: BAC05177.1 .
    AC005358 Genomic DNA. No translation available.
    BC126307 mRNA. Translation: AAI26308.1 .
    BC143391 mRNA. Translation: AAI43392.1 .
    CCDSi CCDS11163.1. [Q8IZQ8-1 ]
    CCDS54091.1. [Q8IZQ8-3 ]
    RefSeqi NP_001139784.1. NM_001146312.2. [Q8IZQ8-3 ]
    NP_705832.1. NM_153604.3. [Q8IZQ8-1 ]
    UniGenei Hs.462257.
    Hs.567641.

    3D structure databases

    ProteinModelPortali Q8IZQ8.
    SMRi Q8IZQ8. Positions 14-129, 363-413.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 125044. 14 interactions.
    IntActi Q8IZQ8. 2 interactions.
    STRINGi 9606.ENSP00000341835.

    PTM databases

    PhosphoSitei Q8IZQ8.

    Polymorphism databases

    DMDMi 32363335.

    Proteomic databases

    MaxQBi Q8IZQ8.
    PaxDbi Q8IZQ8.
    PRIDEi Q8IZQ8.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000343344 ; ENSP00000341835 ; ENSG00000141052 . [Q8IZQ8-1 ]
    ENST00000425538 ; ENSP00000401678 ; ENSG00000141052 . [Q8IZQ8-3 ]
    GeneIDi 93649.
    KEGGi hsa:93649.
    UCSCi uc002gnn.2. human. [Q8IZQ8-1 ]
    uc002gno.2. human. [Q8IZQ8-3 ]
    uc002gnp.1. human. [Q8IZQ8-2 ]

    Organism-specific databases

    CTDi 93649.
    GeneCardsi GC17P012569.
    H-InvDB HIX0027347.
    HGNCi HGNC:16067. MYOCD.
    HPAi CAB046485.
    MIMi 606127. gene.
    neXtProti NX_Q8IZQ8.
    PharmGKBi PA134946896.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG79803.
    HOGENOMi HOG000038001.
    HOVERGENi HBG036493.
    OMAi SFTESPW.
    OrthoDBi EOG7VMP4N.
    PhylomeDBi Q8IZQ8.
    TreeFami TF326024.

    Miscellaneous databases

    GeneWikii MYOCD.
    GenomeRNAii 93649.
    NextBioi 78180.
    PROi Q8IZQ8.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q8IZQ8.
    Bgeei Q8IZQ8.
    CleanExi HS_MYOCD.
    Genevestigatori Q8IZQ8.

    Family and domain databases

    Gene3Di 1.10.720.30. 1 hit.
    InterProi IPR028721. MYOCD.
    IPR004018. RPEL_repeat.
    IPR003034. SAP_dom.
    [Graphical view ]
    PANTHERi PTHR22793:SF11. PTHR22793:SF11. 1 hit.
    Pfami PF02755. RPEL. 1 hit.
    PF02037. SAP. 1 hit.
    [Graphical view ]
    SMARTi SM00707. RPEL. 3 hits.
    SM00513. SAP. 1 hit.
    [Graphical view ]
    PROSITEi PS51073. RPEL. 3 hits.
    PS50800. SAP. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Potentiation of serum response factor activity by a family of myocardin-related transcription factors."
      Wang D.-Z., Li S., Hockemeyer D., Sutherland L., Wang Z., Schratt G., Richardson J.A., Nordheim A., Olson E.N.
      Proc. Natl. Acad. Sci. U.S.A. 99:14855-14860(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    2. "Myocardin is a critical serum response factor cofactor in the transcriptional program regulating smooth muscle cell differentiation."
      Du K.L., Ip H.S., Li J., Chen M., Dandre F., Yu W., Lu M.M., Owens G.K., Parmacek M.S.
      Mol. Cell. Biol. 23:2425-2437(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), FUNCTION, TISSUE SPECIFICITY.
      Tissue: Heart.
    3. "Activation of cardiac and smooth muscle-specific genes in primary human cells after forced expression of human myocardin."
      van Tuyn J., Knaan-Shanzer S., van de Watering M.J., de Graaf M., van der Laarse A., Schalij M.J., van der Wall E.E., de Vries A.A., Atsma D.E.
      Cardiovasc. Res. 67:245-255(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3).
    4. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3).
      Tissue: Testis.
    5. "DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage."
      Zody M.C., Garber M., Adams D.J., Sharpe T., Harrow J., Lupski J.R., Nicholson C., Searle S.M., Wilming L., Young S.K., Abouelleil A., Allen N.R., Bi W., Bloom T., Borowsky M.L., Bugalter B.E., Butler J., Chang J.L.
      , Chen C.-K., Cook A., Corum B., Cuomo C.A., de Jong P.J., DeCaprio D., Dewar K., FitzGerald M., Gilbert J., Gibson R., Gnerre S., Goldstein S., Grafham D.V., Grocock R., Hafez N., Hagopian D.S., Hart E., Norman C.H., Humphray S., Jaffe D.B., Jones M., Kamal M., Khodiyar V.K., LaButti K., Laird G., Lehoczky J., Liu X., Lokyitsang T., Loveland J., Lui A., Macdonald P., Major J.E., Matthews L., Mauceli E., McCarroll S.A., Mihalev A.H., Mudge J., Nguyen C., Nicol R., O'Leary S.B., Osoegawa K., Schwartz D.C., Shaw-Smith C., Stankiewicz P., Steward C., Swarbreck D., Venkataraman V., Whittaker C.A., Yang X., Zimmer A.R., Bradley A., Hubbard T., Birren B.W., Rogers J., Lander E.S., Nusbaum C.
      Nature 440:1045-1049(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
    7. "Myocardin mRNA is augmented in the failing myocardium: expression profiling in the porcine model and human dilated cardiomyopathy."
      Torrado M., Lopez E., Centeno A., Medrano C., Castro-Beiras A., Mikhailov A.T.
      J. Mol. Med. 81:566-577(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: ALTERNATIVE SPLICING (ISOFORMS 1; 2 AND 3), INDUCTION.
    8. "Phenotypic modulation of smooth muscle cells through interaction of Foxo4 and myocardin."
      Liu Z.-P., Wang Z., Yanagisawa H., Olson E.N.
      Dev. Cell 9:261-270(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH MLLT7.
    9. "Expression and functional activity of four myocardin isoforms."
      Imamura M., Long X., Nanda V., Miano J.M.
      Gene 464:1-10(2010) [PubMed] [Europe PMC] [Abstract]
      Cited for: TISSUE SPECIFICITY OF ISOFORMS.

    Entry informationi

    Entry nameiMYCD_HUMAN
    AccessioniPrimary (citable) accession number: Q8IZQ8
    Secondary accession number(s): Q5UBU5, Q8N7Q1
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: June 27, 2003
    Last sequence update: March 1, 2003
    Last modified: October 1, 2014
    This is version 113 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 17
      Human chromosome 17: entries, gene names and cross-references to MIM
    2. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    3. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3