Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Ral-GDS-related protein

Gene

RGL4

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at transcript leveli

Functioni

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Guanine-nucleotide releasing factor

Enzyme and pathway databases

BioCyciZFISH:ENSG00000159496-MONOMER.

Names & Taxonomyi

Protein namesi
Recommended name:
Ral-GDS-related protein
Short name:
hRGR
Alternative name(s):
Ral guanine nucleotide dissociation stimulator-like 4
Short name:
RalGDS-like 4
Gene namesi
Name:RGL4
Synonyms:RGR
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 22

Organism-specific databases

HGNCiHGNC:31911. RGL4.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cytoplasmic vesicle

Pathology & Biotechi

Organism-specific databases

DisGeNETi266747.
OpenTargetsiENSG00000159496.
PharmGKBiPA162401277.

Polymorphism and mutation databases

BioMutaiRGL4.
DMDMi34222891.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000688901 – 473Ral-GDS-related proteinAdd BLAST473

Proteomic databases

PaxDbiQ8IZJ4.
PRIDEiQ8IZJ4.

PTM databases

iPTMnetiQ8IZJ4.
PhosphoSitePlusiQ8IZJ4.

Expressioni

Gene expression databases

BgeeiENSG00000159496.
CleanExiHS_RGL4.
HS_RGR.
ExpressionAtlasiQ8IZJ4. baseline and differential.
GenevisibleiQ8IZJ4. HS.

Organism-specific databases

HPAiHPA035979.

Interactioni

Protein-protein interaction databases

BioGridi129336. 6 interactors.
STRINGi9606.ENSP00000290691.

Structurei

3D structure databases

ProteinModelPortaliQ8IZJ4.
SMRiQ8IZJ4.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini219 – 471Ras-GEFPROSITE-ProRule annotationAdd BLAST253

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi116 – 220Pro-richAdd BLAST105

Sequence similaritiesi

Contains 1 Ras-GEF domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiKOG3629. Eukaryota.
ENOG410ZUT5. LUCA.
GeneTreeiENSGT00860000133700.
HOGENOMiHOG000231592.
HOVERGENiHBG005864.
InParanoidiQ8IZJ4.
PhylomeDBiQ8IZJ4.
TreeFamiTF342571.

Family and domain databases

CDDicd00155. RasGEF. 1 hit.
Gene3Di1.10.840.10. 1 hit.
InterProiIPR023578. Ras_GEF_dom.
IPR001895. RASGEF_cat_dom.
[Graphical view]
PfamiPF00617. RasGEF. 1 hit.
[Graphical view]
SMARTiSM00147. RasGEF. 1 hit.
[Graphical view]
SUPFAMiSSF48366. SSF48366. 1 hit.
PROSITEiPS50009. RASGEF_CAT. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Note: A number of isoforms are produced.
Isoform 1 (identifier: Q8IZJ4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MRKLLTNLPA AAVLSAQVYS AVLQGLWEEN VCGTPGRTRV CTALLYGQVC
60 70 80 90 100
PFQDSTDGLR TITSILFNWP PENTSVYYQP PQRSSFRIKL AFRNLSWPGL
110 120 130 140 150
GLEDHQEIVL GQLVLPEPNE AKPDDPAPRP GQHALTMPAL EPAPPLLADL
160 170 180 190 200
GPALEPESPA ALGPPGYLHS APGPAPAPGE GPPPGTVLEP QSAPESSCPC
210 220 230 240 250
RGSVKNQPSE ELPDMTTFPP RLLAEQLTLM DAELFKKVVL HECLGCIWGQ
260 270 280 290 300
GHLKGNEHMA PTVRATIAHF NRLTNCITTS CLGDHSMRAR DRARVVEHWI
310 320 330 340 350
KVARECLSLN NFSSVHVIVS ALCSNPIGQL HKTWAGVSSK SMKELKELCK
360 370 380 390 400
KDTAVKRDLL IKAGSFKVAT QERNPQRVQM RLRRQKKGVV PFLGDFLTEL
410 420 430 440 450
QRLDSAIPDD LDGNTNKRSK EVRVLQEMQL LQVAAMNYRL RPLEKFVTYF
460 470
TRMEQLSDKE SYKLSCQLEP ENP
Length:473
Mass (Da):52,346
Last modified:March 1, 2003 - v1
Checksum:i6830037DF2DA0FE0
GO
Isoform 2 (identifier: Q8IZJ4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     461-473: SYKLSCQLEPENP → RWGFTMMSRIVSNSWPQAIHPPQPPKVLTLQV

Note: No experimental confirmation available.
Show »
Length:492
Mass (Da):54,542
Checksum:iBB134EB7BE4D8E70
GO

Sequence cautioni

The sequence AAI01109 differs from that shown. Reason: Frameshift at position 61.Curated

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_01624424Q → R.1 PublicationCorresponds to variant rs738786dbSNPEnsembl.1
Natural variantiVAR_05190537R → C.Corresponds to variant rs17003394dbSNPEnsembl.1
Natural variantiVAR_051906216T → M.Corresponds to variant rs17003397dbSNPEnsembl.1
Natural variantiVAR_016245241H → Y.1 PublicationCorresponds to variant rs2070446dbSNPEnsembl.1
Natural variantiVAR_051907297E → K.Corresponds to variant rs17003398dbSNPEnsembl.1
Natural variantiVAR_016246342M → R.Corresponds to variant rs2070449dbSNPEnsembl.1
Natural variantiVAR_051908358D → V.Corresponds to variant rs8137247dbSNPEnsembl.1
Natural variantiVAR_016247378V → A.1 PublicationCorresponds to variant rs1007298dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_055850461 – 473SYKLS…EPENP → RWGFTMMSRIVSNSWPQAIH PPQPPKVLTLQV in isoform 2. 1 PublicationAdd BLAST13

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY101396 mRNA. Translation: AAM51551.1.
AP000347 Genomic DNA. No translation available.
BC101108 mRNA. Translation: AAI01109.1. Frameshift.
CCDSiCCDS13811.1. [Q8IZJ4-1]
RefSeqiNP_001316353.1. NM_001329424.1.
NP_001316354.1. NM_001329425.1.
NP_705843.1. NM_153615.1. [Q8IZJ4-1]
UniGeneiHs.658997.

Genome annotation databases

EnsembliENST00000290691; ENSP00000290691; ENSG00000159496. [Q8IZJ4-1]
GeneIDi266747.
KEGGihsa:266747.
UCSCiuc002zxn.4. human. [Q8IZJ4-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY101396 mRNA. Translation: AAM51551.1.
AP000347 Genomic DNA. No translation available.
BC101108 mRNA. Translation: AAI01109.1. Frameshift.
CCDSiCCDS13811.1. [Q8IZJ4-1]
RefSeqiNP_001316353.1. NM_001329424.1.
NP_001316354.1. NM_001329425.1.
NP_705843.1. NM_153615.1. [Q8IZJ4-1]
UniGeneiHs.658997.

3D structure databases

ProteinModelPortaliQ8IZJ4.
SMRiQ8IZJ4.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi129336. 6 interactors.
STRINGi9606.ENSP00000290691.

PTM databases

iPTMnetiQ8IZJ4.
PhosphoSitePlusiQ8IZJ4.

Polymorphism and mutation databases

BioMutaiRGL4.
DMDMi34222891.

Proteomic databases

PaxDbiQ8IZJ4.
PRIDEiQ8IZJ4.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000290691; ENSP00000290691; ENSG00000159496. [Q8IZJ4-1]
GeneIDi266747.
KEGGihsa:266747.
UCSCiuc002zxn.4. human. [Q8IZJ4-1]

Organism-specific databases

CTDi266747.
DisGeNETi266747.
GeneCardsiRGL4.
HGNCiHGNC:31911. RGL4.
HPAiHPA035979.
MIMi612214. gene.
neXtProtiNX_Q8IZJ4.
OpenTargetsiENSG00000159496.
PharmGKBiPA162401277.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG3629. Eukaryota.
ENOG410ZUT5. LUCA.
GeneTreeiENSGT00860000133700.
HOGENOMiHOG000231592.
HOVERGENiHBG005864.
InParanoidiQ8IZJ4.
PhylomeDBiQ8IZJ4.
TreeFamiTF342571.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000159496-MONOMER.

Miscellaneous databases

GenomeRNAii266747.
PROiQ8IZJ4.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000159496.
CleanExiHS_RGL4.
HS_RGR.
ExpressionAtlasiQ8IZJ4. baseline and differential.
GenevisibleiQ8IZJ4. HS.

Family and domain databases

CDDicd00155. RasGEF. 1 hit.
Gene3Di1.10.840.10. 1 hit.
InterProiIPR023578. Ras_GEF_dom.
IPR001895. RASGEF_cat_dom.
[Graphical view]
PfamiPF00617. RasGEF. 1 hit.
[Graphical view]
SMARTiSM00147. RasGEF. 1 hit.
[Graphical view]
SUPFAMiSSF48366. SSF48366. 1 hit.
PROSITEiPS50009. RASGEF_CAT. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiRGDSR_HUMAN
AccessioniPrimary (citable) accession number: Q8IZJ4
Secondary accession number(s): Q495L8
Entry historyi
Integrated into UniProtKB/Swiss-Prot: August 22, 2003
Last sequence update: March 1, 2003
Last modified: November 30, 2016
This is version 109 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 22
    Human chromosome 22: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.