Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Adhesion G-protein coupled receptor F3

Gene

ADGRF3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at transcript leveli

Functioni

Orphan receptor.

GO - Molecular functioni

  • G-protein coupled receptor activity Source: GDB

GO - Biological processi

  • cell surface receptor signaling pathway Source: InterPro
  • G-protein coupled receptor signaling pathway Source: GDB
Complete GO annotation...

Keywords - Molecular functioni

G-protein coupled receptor, Receptor, Transducer

Protein family/group databases

MEROPSiP02.028.

Names & Taxonomyi

Protein namesi
Recommended name:
Adhesion G-protein coupled receptor F3
Alternative name(s):
G-protein coupled receptor 113
G-protein coupled receptor PGR23
Gene namesi
Name:ADGRF3
Synonyms:GPR113, PGR23
ORF Names:UNQ9196/PRO34000
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 2

Organism-specific databases

HGNCiHGNC:18989. ADGRF3.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini26 – 775ExtracellularCuratedAdd BLAST750
Transmembranei776 – 796Helical; Name=1Sequence analysisAdd BLAST21
Topological domaini797 – 811CytoplasmicCuratedAdd BLAST15
Transmembranei812 – 832Helical; Name=2Sequence analysisAdd BLAST21
Topological domaini833 – 851ExtracellularCuratedAdd BLAST19
Transmembranei852 – 874Helical; Name=3Sequence analysisAdd BLAST23
Topological domaini875 – 881CytoplasmicCurated7
Transmembranei882 – 902Helical; Name=4Sequence analysisAdd BLAST21
Topological domaini903 – 928ExtracellularCuratedAdd BLAST26
Transmembranei929 – 949Helical; Name=5Sequence analysisAdd BLAST21
Topological domaini950 – 973CytoplasmicCuratedAdd BLAST24
Transmembranei974 – 994Helical; Name=6Sequence analysisAdd BLAST21
Topological domaini995 – 1002ExtracellularCurated8
Transmembranei1003 – 1023Helical; Name=7Sequence analysisAdd BLAST21
Topological domaini1024 – 1079CytoplasmicCuratedAdd BLAST56

GO - Cellular componenti

  • integral component of membrane Source: GDB
Complete GO annotation...

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000173567.
PharmGKBiPA134918027.

Polymorphism and mutation databases

BioMutaiGPR113.
DMDMi59797951.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 25Sequence analysisAdd BLAST25
ChainiPRO_000001289326 – 1079Adhesion G-protein coupled receptor F3Add BLAST1054

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi188N-linked (GlcNAc...)Sequence analysis1
Glycosylationi264N-linked (GlcNAc...)Sequence analysis1
Glycosylationi301N-linked (GlcNAc...)Sequence analysis1
Glycosylationi382N-linked (GlcNAc...)Sequence analysis1
Glycosylationi441N-linked (GlcNAc...)Sequence analysis1
Glycosylationi648N-linked (GlcNAc...)Sequence analysis1

Keywords - PTMi

Glycoprotein

Proteomic databases

MaxQBiQ8IZF5.
PaxDbiQ8IZF5.
PeptideAtlasiQ8IZF5.
PRIDEiQ8IZF5.

PTM databases

iPTMnetiQ8IZF5.
PhosphoSitePlusiQ8IZF5.

Expressioni

Gene expression databases

BgeeiENSG00000173567.
CleanExiHS_GPR113.
ExpressionAtlasiQ8IZF5. baseline and differential.
GenevisibleiQ8IZF5. HS.

Organism-specific databases

HPAiHPA044500.

Interactioni

Protein-protein interaction databases

BioGridi127907. 1 interactor.
STRINGi9606.ENSP00000307831.

Structurei

3D structure databases

ProteinModelPortaliQ8IZF5.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini712 – 764GPSPROSITE-ProRule annotationAdd BLAST53

Sequence similaritiesi

Contains 1 GPS domain.PROSITE-ProRule annotation

Keywords - Domaini

Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG4193. Eukaryota.
ENOG410XSD2. LUCA.
GeneTreeiENSGT00830000128272.
HOGENOMiHOG000112763.
HOVERGENiHBG051770.
InParanoidiQ8IZF5.
KOiK08456.
OMAiWNVTKAG.
OrthoDBiEOG091G022O.
PhylomeDBiQ8IZF5.
TreeFamiTF316380.

Family and domain databases

InterProiIPR017981. GPCR_2-like.
IPR001879. GPCR_2_extracellular_dom.
IPR000832. GPCR_2_secretin-like.
IPR017983. GPCR_2_secretin-like_CS.
IPR000203. GPS.
[Graphical view]
PfamiPF00002. 7tm_2. 1 hit.
PF01825. GPS. 1 hit.
PF02793. HRM. 1 hit.
[Graphical view]
PRINTSiPR00249. GPCRSECRETIN.
SMARTiSM00303. GPS. 1 hit.
[Graphical view]
PROSITEiPS00650. G_PROTEIN_RECEP_F2_2. 1 hit.
PS50227. G_PROTEIN_RECEP_F2_3. 1 hit.
PS50261. G_PROTEIN_RECEP_F2_4. 1 hit.
PS50221. GPS. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8IZF5-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MVCSAAPLLL LATTLPLLGS PVAQASQPVS ETGVRPREGL QRRQWGPLIG
60 70 80 90 100
RDKAWNERID RPFPACPIPL SSSFGRWPKG QTMWAQTSTL TLTEEELGQS
110 120 130 140 150
QAGGESGSGQ LLDQENGAGE SALVSVYVHL DFPDKTWPPE LSRTLTLPAA
160 170 180 190 200
SASSSPRPLL TGLRLTTECN VNHKGNFYCA CLSGYQWNTS ICLHYPPCQS
210 220 230 240 250
LHNHQPCGCL VFSHPEPGYC QLLPPGSPVT CLPAVPGILN LNSQLQMPGD
260 270 280 290 300
TLSLTLHLSQ EATNLSWFLR HPGSPSPILL QPGTQVSVTS SHGQAALSVS
310 320 330 340 350
NMSHHWAGEY MSCFEAQGFK WNLYEVVRVP LKATDVARLP YQLSISCATS
360 370 380 390 400
PGFQLSCCIP STNLAYTAAW SPGEGSKASS FNESGSQCFV LAVQRCPMAD
410 420 430 440 450
TTYACDLQSL GLAPLRVPIS ITIIQDGDIT CPEDASVLTW NVTKAGHVAQ
460 470 480 490 500
APCPESKRGI VRRLCGADGV WGPVHSSCTD ARLLALFTRT KLLQAGQGSP
510 520 530 540 550
AEEVPQILAQ LPGQAAEASS PSDLLTLLST MKYVAKVVAE ARIQLDRRAL
560 570 580 590 600
KNLLIATDKV LDMDTRSLWT LAQARKPWAG STLLLAVETL ACSLCPQDHP
610 620 630 640 650
FAFSLPNVLL QSQLFGPTFP ADYSISFPTR PPLQAQIPRH SLAPLVRNGT
660 670 680 690 700
EISITSLVLR KLDHLLPSNY GQGLGDSLYA TPGLVLVISI MAGDRAFSQG
710 720 730 740 750
EVIMDFGNTD GSPHCVFWDH SLFQGRGGWS KEGCQAQVAS ASPTAQCLCQ
760 770 780 790 800
HLTAFSVLMS PHTVPEEPAL ALLTQVGLGA SILALLVCLG VYWLVWRVVV
810 820 830 840 850
RNKISYFRHA ALLNMVFCLL AADTCFLGAP FLSPGPRSPL CLAAAFLCHF
860 870 880 890 900
LYLATFFWML AQALVLAHQL LFVFHQLAKH RVLPLMVLLG YLCPLGLAGV
910 920 930 940 950
TLGLYLPQGQ YLREGECWLD GKGGALYTFV GPVLAIIGVN GLVLAMAMLK
960 970 980 990 1000
LLRPSLSEGP PAEKRQALLG VIKALLILTP IFGLTWGLGL ATLLEEVSTV
1010 1020 1030 1040 1050
PHYIFTILNT LQGVFILLFG CLMDRKIQEA LRKRFCRAQA PSSTISLVSC
1060 1070
CLQILSCASK SMSEGIPWPS SEDMGTARS
Length:1,079
Mass (Da):116,341
Last modified:March 1, 2003 - v1
Checksum:iA18CA158F4DDBB9C
GO
Isoform 2 (identifier: Q8IZF5-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-97: MVCSAAPLLL...STLTLTEEEL → MTTRKLSAHS...RMAKTGLPEK
     168-307: Missing.
     1048-1079: VSCCLQILSCASKSMSEGIPWPSSEDMGTARS → ATNEGCILEHSKGGSDTARKTDASE

Show »
Length:873
Mass (Da):93,912
Checksum:i03A8E3E3AEEDE1C8
GO
Isoform 3 (identifier: Q8IZF5-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     29-97: Missing.
     1048-1079: VSCCLQILSCASKSMSEGIPWPSSEDMGTARS → ATNEGCILEHSKGGSDTAR

Note: No experimental confirmation available.
Show »
Length:997
Mass (Da):107,020
Checksum:i3319FE1B2BBDB3B3
GO

Sequence cautioni

The sequence BAB89332 differs from that shown. Reason: Erroneous initiation.Curated
The sequence BAC45265 differs from that shown. Reason: Erroneous gene model prediction.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti348A → V in AAQ88539 (PubMed:12975309).Curated1
Sequence conflicti599H → Y in AAQ88539 (PubMed:12975309).Curated1
Sequence conflicti765P → S in BAG57276 (PubMed:14702039).Curated1
Sequence conflicti886M → T in AAQ88581 (PubMed:12975309).Curated1
Isoform 2 (identifier: Q8IZF5-2)
Sequence conflicti868K → N in AAQ88581 (PubMed:12975309).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_024475404A → T.1 PublicationCorresponds to variant rs2052937dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0128151 – 97MVCSA…TEEEL → MTTRKLSAHSAATPGYKAVT HKHHTGWARMAKTGLPEK in isoform 2. 1 PublicationAdd BLAST97
Alternative sequenceiVSP_04617429 – 97Missing in isoform 3. 1 PublicationAdd BLAST69
Alternative sequenceiVSP_012816168 – 307Missing in isoform 2. 1 PublicationAdd BLAST140
Alternative sequenceiVSP_0128171048 – 1079VSCCL…GTARS → ATNEGCILEHSKGGSDTARK TDASE in isoform 2. 1 PublicationAdd BLAST32
Alternative sequenceiVSP_0461751048 – 1079VSCCL…GTARS → ATNEGCILEHSKGGSDTAR in isoform 3. 1 PublicationAdd BLAST32

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY140955 mRNA. Translation: AAN46669.1.
AB065959 Genomic DNA. Translation: BAC45265.1. Sequence problems.
AY358172 mRNA. Translation: AAQ88539.1.
AY358214 Transcribed RNA. Translation: AAQ88581.1.
AB083619 Genomic DNA. Translation: BAB89332.1. Different initiation.
AK293887 mRNA. Translation: BAG57276.1.
AC010896 Genomic DNA. Translation: AAY14645.1.
AY255611 mRNA. Translation: AAO85123.1.
CCDSiCCDS33159.2. [Q8IZF5-2]
CCDS46238.1. [Q8IZF5-3]
CCDS46239.1. [Q8IZF5-1]
RefSeqiNP_001138640.1. NM_001145168.1. [Q8IZF5-1]
NP_001138641.1. NM_001145169.1. [Q8IZF5-3]
NP_001308900.1. NM_001321971.1.
NP_001308904.1. NM_001321975.1.
NP_722577.2. NM_153835.3. [Q8IZF5-2]
UniGeneiHs.631878.

Genome annotation databases

EnsembliENST00000311519; ENSP00000307831; ENSG00000173567. [Q8IZF5-1]
ENST00000333478; ENSP00000327396; ENSG00000173567. [Q8IZF5-2]
ENST00000421160; ENSP00000388537; ENSG00000173567. [Q8IZF5-3]
ENST00000447444; ENSP00000404775; ENSG00000173567. [Q8IZF5-2]
GeneIDi165082.
KEGGihsa:165082.
UCSCiuc002rhd.2. human. [Q8IZF5-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY140955 mRNA. Translation: AAN46669.1.
AB065959 Genomic DNA. Translation: BAC45265.1. Sequence problems.
AY358172 mRNA. Translation: AAQ88539.1.
AY358214 Transcribed RNA. Translation: AAQ88581.1.
AB083619 Genomic DNA. Translation: BAB89332.1. Different initiation.
AK293887 mRNA. Translation: BAG57276.1.
AC010896 Genomic DNA. Translation: AAY14645.1.
AY255611 mRNA. Translation: AAO85123.1.
CCDSiCCDS33159.2. [Q8IZF5-2]
CCDS46238.1. [Q8IZF5-3]
CCDS46239.1. [Q8IZF5-1]
RefSeqiNP_001138640.1. NM_001145168.1. [Q8IZF5-1]
NP_001138641.1. NM_001145169.1. [Q8IZF5-3]
NP_001308900.1. NM_001321971.1.
NP_001308904.1. NM_001321975.1.
NP_722577.2. NM_153835.3. [Q8IZF5-2]
UniGeneiHs.631878.

3D structure databases

ProteinModelPortaliQ8IZF5.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi127907. 1 interactor.
STRINGi9606.ENSP00000307831.

Protein family/group databases

MEROPSiP02.028.
GPCRDBiSearch...

PTM databases

iPTMnetiQ8IZF5.
PhosphoSitePlusiQ8IZF5.

Polymorphism and mutation databases

BioMutaiGPR113.
DMDMi59797951.

Proteomic databases

MaxQBiQ8IZF5.
PaxDbiQ8IZF5.
PeptideAtlasiQ8IZF5.
PRIDEiQ8IZF5.

Protocols and materials databases

DNASUi165082.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000311519; ENSP00000307831; ENSG00000173567. [Q8IZF5-1]
ENST00000333478; ENSP00000327396; ENSG00000173567. [Q8IZF5-2]
ENST00000421160; ENSP00000388537; ENSG00000173567. [Q8IZF5-3]
ENST00000447444; ENSP00000404775; ENSG00000173567. [Q8IZF5-2]
GeneIDi165082.
KEGGihsa:165082.
UCSCiuc002rhd.2. human. [Q8IZF5-1]

Organism-specific databases

CTDi165082.
GeneCardsiADGRF3.
HGNCiHGNC:18989. ADGRF3.
HPAiHPA044500.
neXtProtiNX_Q8IZF5.
OpenTargetsiENSG00000173567.
PharmGKBiPA134918027.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG4193. Eukaryota.
ENOG410XSD2. LUCA.
GeneTreeiENSGT00830000128272.
HOGENOMiHOG000112763.
HOVERGENiHBG051770.
InParanoidiQ8IZF5.
KOiK08456.
OMAiWNVTKAG.
OrthoDBiEOG091G022O.
PhylomeDBiQ8IZF5.
TreeFamiTF316380.

Miscellaneous databases

GeneWikiiGPR113.
GenomeRNAii165082.
PROiQ8IZF5.

Gene expression databases

BgeeiENSG00000173567.
CleanExiHS_GPR113.
ExpressionAtlasiQ8IZF5. baseline and differential.
GenevisibleiQ8IZF5. HS.

Family and domain databases

InterProiIPR017981. GPCR_2-like.
IPR001879. GPCR_2_extracellular_dom.
IPR000832. GPCR_2_secretin-like.
IPR017983. GPCR_2_secretin-like_CS.
IPR000203. GPS.
[Graphical view]
PfamiPF00002. 7tm_2. 1 hit.
PF01825. GPS. 1 hit.
PF02793. HRM. 1 hit.
[Graphical view]
PRINTSiPR00249. GPCRSECRETIN.
SMARTiSM00303. GPS. 1 hit.
[Graphical view]
PROSITEiPS00650. G_PROTEIN_RECEP_F2_2. 1 hit.
PS50227. G_PROTEIN_RECEP_F2_3. 1 hit.
PS50261. G_PROTEIN_RECEP_F2_4. 1 hit.
PS50221. GPS. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiAGRF3_HUMAN
AccessioniPrimary (citable) accession number: Q8IZF5
Secondary accession number(s): B4DF15
, E9PEV1, Q53TA5, Q6UXT7, Q6UXX3, Q86SL7, Q8IXD8, Q8TDT3
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 15, 2005
Last sequence update: March 1, 2003
Last modified: November 2, 2016
This is version 127 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. 7-transmembrane G-linked receptors
    List of 7-transmembrane G-linked receptor entries
  2. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.