Q8IZF5 (GP113_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 29, 2013.
Version 97.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Probable G-protein coupled receptor 113 Alternative name(s): G-protein coupled receptor PGR23 | ||||||
| Gene names |
| ||||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||||
| Taxonomic identifier | 9606 [NCBI] | ||||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 1079 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Function | Orphan receptor. |
| Subcellular location | |
| Sequence similarities | Belongs to the G-protein coupled receptor 2 family. LN-TM7 subfamily. Contains 1 GPS domain. |
| Sequence caution | The sequence BAB89332.1 differs from that shown. Reason: Erroneous initiation. The sequence BAC45265.1 differs from that shown. Reason: Erroneous gene model prediction. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cell membrane Membrane |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Signal Transmembrane Transmembrane helix |
| Molecular function | G-protein coupled receptor Receptor Transducer |
| PTM | Glycoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | neuropeptide signaling pathway Inferred from electronic annotation. Source: InterPro |
| Cellular_component | integral to membrane Traceable author statement PubMed 15203201. Source: GDB plasma membraneInferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular_function | G-protein coupled receptor activity Traceable author statement PubMed 15203201. Source: GDB |
| Complete GO annotation... | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q8IZF5-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q8IZF5-2) The sequence of this isoform differs from the canonical sequence as follows: 1-97: MVCSAAPLLL...STLTLTEEEL → MTTRKLSAHS...RMAKTGLPEK 168-307: Missing. 1048-1079: VSCCLQILSCASKSMSEGIPWPSSEDMGTARS → ATNEGCILEHSKGGSDTARKTDASE | ||||||
| Isoform 3 (identifier: Q8IZF5-3) The sequence of this isoform differs from the canonical sequence as follows: 29-97: Missing. 1048-1079: VSCCLQILSCASKSMSEGIPWPSSEDMGTARS → ATNEGCILEHSKGGSDTAR | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 25 | 25 | Potential | ||||||
| Chain | 26 – 1079 | 1054 | Probable G-protein coupled receptor 113 | PRO_0000012893 | |||||
Regions | |||||||||
| Topological domain | 26 – 775 | 750 | Extracellular Potential | ||||||
| Transmembrane | 776 – 796 | 21 | Helical; Name=1; Potential | ||||||
| Topological domain | 797 – 811 | 15 | Cytoplasmic Potential | ||||||
| Transmembrane | 812 – 832 | 21 | Helical; Name=2; Potential | ||||||
| Topological domain | 833 – 851 | 19 | Extracellular Potential | ||||||
| Transmembrane | 852 – 874 | 23 | Helical; Name=3; Potential | ||||||
| Topological domain | 875 – 881 | 7 | Cytoplasmic Potential | ||||||
| Transmembrane | 882 – 902 | 21 | Helical; Name=4; Potential | ||||||
| Topological domain | 903 – 928 | 26 | Extracellular Potential | ||||||
| Transmembrane | 929 – 949 | 21 | Helical; Name=5; Potential | ||||||
| Topological domain | 950 – 973 | 24 | Cytoplasmic Potential | ||||||
| Transmembrane | 974 – 994 | 21 | Helical; Name=6; Potential | ||||||
| Topological domain | 995 – 1002 | 8 | Extracellular Potential | ||||||
| Transmembrane | 1003 – 1023 | 21 | Helical; Name=7; Potential | ||||||
| Topological domain | 1024 – 1079 | 56 | Cytoplasmic Potential | ||||||
| Domain | 712 – 764 | 53 | GPS | ||||||
Amino acid modifications | |||||||||
| Glycosylation | 188 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 264 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 301 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 382 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 441 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 648 | 1 | N-linked (GlcNAc...) Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 97 | 97 | MVCSA…TEEEL → MTTRKLSAHSAATPGYKAVT HKHHTGWARMAKTGLPEK in isoform 2. | VSP_012815 | |||||
| Alternative sequence | 29 – 97 | 69 | Missing in isoform 3. | VSP_046174 | |||||
| Alternative sequence | 168 – 307 | 140 | Missing in isoform 2. | VSP_012816 | |||||
| Alternative sequence | 1048 – 1079 | 32 | VSCCL…GTARS → ATNEGCILEHSKGGSDTARK TDASE in isoform 2. | VSP_012817 | |||||
| Alternative sequence | 1048 – 1079 | 32 | VSCCL…GTARS → ATNEGCILEHSKGGSDTAR in isoform 3. | VSP_046175 | |||||
| Natural variant | 404 | 1 | A → T. Ref.3 Corresponds to variant rs2052937 [ dbSNP | Ensembl ]. | VAR_024475 | |||||
Experimental info | |||||||||
| Sequence conflict | 348 | 1 | A → V in AAQ88539. Ref.3 | ||||||
| Sequence conflict | 599 | 1 | H → Y in AAQ88539. Ref.3 | ||||||
| Sequence conflict | 765 | 1 | P → S in BAG57276. Ref.4 | ||||||
| Sequence conflict | 886 | 1 | M → T in AAQ88581. Ref.3 | ||||||
| Isoform 2: | |||||||||
| Sequence conflict | 868 | 1 | K → N in AAQ88581. Ref.3 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Novel human G protein-coupled receptors with long N-terminals containing GPS domains and Ser/Thr-rich regions." Fredriksson R., Lagerstroem M.C., Hoeglund P.J., Schioeth H.B. FEBS Lett. 531:407-414(2002) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [2] | "Genome-wide discovery and analysis of human seven transmembrane helix receptor genes." Suwa M., Sato T., Okouchi I., Arita M., Futami K., Matsumoto S., Tsutsumi S., Aburatani H., Asai K., Akiyama Y. Submitted (JUL-2001) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. |
| [3] | "The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment." Clark H.F., Gurney A.L., Abaya E., Baker K., Baldwin D.T., Brush J., Chen J., Chow B., Chui C., Crowley C., Currell B., Deuel B., Dowd P., Eaton D., Foster J.S., Grimaldi C., Gu Q., Hass P.E. Gray A.M.Genome Res. 13:2265-2270(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), VARIANT THR-404. |
| [4] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3). Tissue: Cerebellum. |
| [5] | "Generation and annotation of the DNA sequences of human chromosomes 2 and 4." Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H. Wilson R.K.Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | "Identification of G protein-coupled receptor genes from the human genome sequence." Takeda S., Kadowaki S., Haga T., Takaesu H., Mitaku S. FEBS Lett. 520:97-101(2002) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA] OF 563-1079. |
| [7] | "The G protein-coupled receptor repertoires of human and mouse." Vassilatis D.K., Hohmann J.G., Zeng H., Li F., Ranchalis J.E., Mortrud M.T., Brown A., Rodriguez S.S., Weller J.R., Wright A.C., Bergmann J.E., Gaitanaris G.A. Proc. Natl. Acad. Sci. U.S.A. 100:4903-4908(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 797-942. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AY140955 mRNA. Translation: AAN46669.1. AB065959 Genomic DNA. Translation: BAC45265.1. Sequence problems. AY358172 mRNA. Translation: AAQ88539.1. AY358214 Transcribed RNA. Translation: AAQ88581.1. AB083619 Genomic DNA. Translation: BAB89332.1. Different initiation. AK293887 mRNA. Translation: BAG57276.1. AC010896 Genomic DNA. Translation: AAY14645.1. AY255611 mRNA. Translation: AAO85123.1. |
| IPI | IPI00218000. IPI00553242. IPI00852794. |
| RefSeq | NP_001138640.1. NM_001145168.1. NP_001138641.1. NM_001145169.1. NP_722577.2. NM_153835.3. |
| UniGene | Hs.631878. |
3D structure databases | |
| ProteinModelPortal | Q8IZF5. |
| ModBase | Search... |
Protein family/group databases | |
| MEROPS | S63.031. |
| GPCRDB | Search... |
PTM databases | |
| PhosphoSite | Q8IZF5. |
Polymorphism databases | |
| DMDM | 59797951. |
Proteomic databases | |
| PaxDb | Q8IZF5. |
| PRIDE | Q8IZF5. |
Protocols and materials databases | |
| DNASU | 165082. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000311519; ENSP00000307831; ENSG00000173567. ENST00000333478; ENSP00000327396; ENSG00000173567. ENST00000421160; ENSP00000388537; ENSG00000173567. ENST00000447444; ENSP00000404775; ENSG00000173567. |
| GeneID | 165082. |
| KEGG | hsa:165082. |
| UCSC | uc002rhe.4. human. uc010eyk.1. human. uc010yky.1. human. |
Organism-specific databases | |
| CTD | 165082. |
| GeneCards | GC02M026444. |
| HGNC | HGNC:18989. GPR113. |
| HPA | HPA044500. |
| neXtProt | NX_Q8IZF5. |
| PharmGKB | PA134918027. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG257112. |
| HOGENOM | HOG000112763. |
| HOVERGEN | HBG051770. |
| InParanoid | Q8IZF5. |
| KO | K08456. |
| OMA | TIIQDGD. |
| PhylomeDB | Q8IZF5. |
Gene expression databases | |
| ArrayExpress | Q8IZF5. |
| Bgee | Q8IZF5. |
| CleanEx | HS_GPR113. |
| Genevestigator | Q8IZF5. |
| GermOnline | ENSG00000173567. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR022624. DUF3497. IPR017981. GPCR_2-like. IPR001879. GPCR_2_extracellular_dom. IPR000832. GPCR_2_secretin-like. IPR017983. GPCR_2_secretin-like_CS. IPR000203. GPS_dom. [Graphical view] |
| Pfam | PF00002. 7tm_2. 1 hit. PF12003. DUF3497. 1 hit. PF01825. GPS. 1 hit. PF02793. HRM. 1 hit. [Graphical view] |
| PRINTS | PR00249. GPCRSECRETIN. |
| SMART | SM00303. GPS. 1 hit. [Graphical view] |
| PROSITE | PS00649. G_PROTEIN_RECEP_F2_1. False negative. PS00650. G_PROTEIN_RECEP_F2_2. 1 hit. PS50227. G_PROTEIN_RECEP_F2_3. 1 hit. PS50261. G_PROTEIN_RECEP_F2_4. 1 hit. PS50221. GPS. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 165082. |
| NextBio | 88517. |
Entry information
| Entry name | GP113_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q8IZF5 Secondary accession number(s): B4DF15 Q8TDT3 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| 7-transmembrane G-linked receptors List of 7-transmembrane G-linked receptor entries |
| Human chromosome 2 Human chromosome 2: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| SIMILARITY comments Index of protein domains and families |

Clusters with
