Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q8IZF5 (GP113_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 107. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (5) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Probable G-protein coupled receptor 113
Alternative name(s):
G-protein coupled receptor PGR23
Gene names
Name:GPR113
Synonyms:PGR23
ORF Names:UNQ9196/PRO34000
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length1079 AA.
Sequence statusComplete.
Sequence processingThe displayed sequence is further processed into a mature form.
Protein existenceEvidence at transcript level

General annotation (Comments)

Function

Orphan receptor.

Subcellular location

Cell membrane; Multi-pass membrane protein.

Sequence similarities

Belongs to the G-protein coupled receptor 2 family. LN-TM7 subfamily.

Contains 1 GPS domain.

Sequence caution

The sequence BAB89332.1 differs from that shown. Reason: Erroneous initiation.

The sequence BAC45265.1 differs from that shown. Reason: Erroneous gene model prediction.

Alternative products

This entry describes 3 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q8IZF5-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q8IZF5-2)

The sequence of this isoform differs from the canonical sequence as follows:
     1-97: MVCSAAPLLL...STLTLTEEEL → MTTRKLSAHS...RMAKTGLPEK
     168-307: Missing.
     1048-1079: VSCCLQILSCASKSMSEGIPWPSSEDMGTARS → ATNEGCILEHSKGGSDTARKTDASE
Isoform 3 (identifier: Q8IZF5-3)

The sequence of this isoform differs from the canonical sequence as follows:
     29-97: Missing.
     1048-1079: VSCCLQILSCASKSMSEGIPWPSSEDMGTARS → ATNEGCILEHSKGGSDTAR
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Signal peptide1 – 2525 Potential
Chain26 – 10791054Probable G-protein coupled receptor 113
PRO_0000012893

Regions

Topological domain26 – 775750Extracellular Potential
Transmembrane776 – 79621Helical; Name=1; Potential
Topological domain797 – 81115Cytoplasmic Potential
Transmembrane812 – 83221Helical; Name=2; Potential
Topological domain833 – 85119Extracellular Potential
Transmembrane852 – 87423Helical; Name=3; Potential
Topological domain875 – 8817Cytoplasmic Potential
Transmembrane882 – 90221Helical; Name=4; Potential
Topological domain903 – 92826Extracellular Potential
Transmembrane929 – 94921Helical; Name=5; Potential
Topological domain950 – 97324Cytoplasmic Potential
Transmembrane974 – 99421Helical; Name=6; Potential
Topological domain995 – 10028Extracellular Potential
Transmembrane1003 – 102321Helical; Name=7; Potential
Topological domain1024 – 107956Cytoplasmic Potential
Domain712 – 76453GPS

Amino acid modifications

Glycosylation1881N-linked (GlcNAc...) Potential
Glycosylation2641N-linked (GlcNAc...) Potential
Glycosylation3011N-linked (GlcNAc...) Potential
Glycosylation3821N-linked (GlcNAc...) Potential
Glycosylation4411N-linked (GlcNAc...) Potential
Glycosylation6481N-linked (GlcNAc...) Potential

Natural variations

Alternative sequence1 – 9797MVCSA…TEEEL → MTTRKLSAHSAATPGYKAVT HKHHTGWARMAKTGLPEK in isoform 2.
VSP_012815
Alternative sequence29 – 9769Missing in isoform 3.
VSP_046174
Alternative sequence168 – 307140Missing in isoform 2.
VSP_012816
Alternative sequence1048 – 107932VSCCL…GTARS → ATNEGCILEHSKGGSDTARK TDASE in isoform 2.
VSP_012817
Alternative sequence1048 – 107932VSCCL…GTARS → ATNEGCILEHSKGGSDTAR in isoform 3.
VSP_046175
Natural variant4041A → T. Ref.3
Corresponds to variant rs2052937 [ dbSNP | Ensembl ].
VAR_024475

Experimental info

Sequence conflict3481A → V in AAQ88539. Ref.3
Sequence conflict5991H → Y in AAQ88539. Ref.3
Sequence conflict7651P → S in BAG57276. Ref.4
Sequence conflict8861M → T in AAQ88581. Ref.3
Isoform 2:
Sequence conflict8681K → N in AAQ88581. Ref.3

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified March 1, 2003. Version 1.
Checksum: A18CA158F4DDBB9C

FASTA1,079116,341
        10         20         30         40         50         60 
MVCSAAPLLL LATTLPLLGS PVAQASQPVS ETGVRPREGL QRRQWGPLIG RDKAWNERID 

        70         80         90        100        110        120 
RPFPACPIPL SSSFGRWPKG QTMWAQTSTL TLTEEELGQS QAGGESGSGQ LLDQENGAGE 

       130        140        150        160        170        180 
SALVSVYVHL DFPDKTWPPE LSRTLTLPAA SASSSPRPLL TGLRLTTECN VNHKGNFYCA 

       190        200        210        220        230        240 
CLSGYQWNTS ICLHYPPCQS LHNHQPCGCL VFSHPEPGYC QLLPPGSPVT CLPAVPGILN 

       250        260        270        280        290        300 
LNSQLQMPGD TLSLTLHLSQ EATNLSWFLR HPGSPSPILL QPGTQVSVTS SHGQAALSVS 

       310        320        330        340        350        360 
NMSHHWAGEY MSCFEAQGFK WNLYEVVRVP LKATDVARLP YQLSISCATS PGFQLSCCIP 

       370        380        390        400        410        420 
STNLAYTAAW SPGEGSKASS FNESGSQCFV LAVQRCPMAD TTYACDLQSL GLAPLRVPIS 

       430        440        450        460        470        480 
ITIIQDGDIT CPEDASVLTW NVTKAGHVAQ APCPESKRGI VRRLCGADGV WGPVHSSCTD 

       490        500        510        520        530        540 
ARLLALFTRT KLLQAGQGSP AEEVPQILAQ LPGQAAEASS PSDLLTLLST MKYVAKVVAE 

       550        560        570        580        590        600 
ARIQLDRRAL KNLLIATDKV LDMDTRSLWT LAQARKPWAG STLLLAVETL ACSLCPQDHP 

       610        620        630        640        650        660 
FAFSLPNVLL QSQLFGPTFP ADYSISFPTR PPLQAQIPRH SLAPLVRNGT EISITSLVLR 

       670        680        690        700        710        720 
KLDHLLPSNY GQGLGDSLYA TPGLVLVISI MAGDRAFSQG EVIMDFGNTD GSPHCVFWDH 

       730        740        750        760        770        780 
SLFQGRGGWS KEGCQAQVAS ASPTAQCLCQ HLTAFSVLMS PHTVPEEPAL ALLTQVGLGA 

       790        800        810        820        830        840 
SILALLVCLG VYWLVWRVVV RNKISYFRHA ALLNMVFCLL AADTCFLGAP FLSPGPRSPL 

       850        860        870        880        890        900 
CLAAAFLCHF LYLATFFWML AQALVLAHQL LFVFHQLAKH RVLPLMVLLG YLCPLGLAGV 

       910        920        930        940        950        960 
TLGLYLPQGQ YLREGECWLD GKGGALYTFV GPVLAIIGVN GLVLAMAMLK LLRPSLSEGP 

       970        980        990       1000       1010       1020 
PAEKRQALLG VIKALLILTP IFGLTWGLGL ATLLEEVSTV PHYIFTILNT LQGVFILLFG 

      1030       1040       1050       1060       1070 
CLMDRKIQEA LRKRFCRAQA PSSTISLVSC CLQILSCASK SMSEGIPWPS SEDMGTARS 

« Hide

Isoform 2 [UniParc].

Checksum: 03A8E3E3AEEDE1C8
Show »

FASTA87393,912
Isoform 3 [UniParc].

Checksum: 3319FE1B2BBDB3B3
Show »

FASTA997107,020

References

« Hide 'large scale' references
[1]"Novel human G protein-coupled receptors with long N-terminals containing GPS domains and Ser/Thr-rich regions."
Fredriksson R., Lagerstroem M.C., Hoeglund P.J., Schioeth H.B.
FEBS Lett. 531:407-414(2002) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
[2]"Genome-wide discovery and analysis of human seven transmembrane helix receptor genes."
Suwa M., Sato T., Okouchi I., Arita M., Futami K., Matsumoto S., Tsutsumi S., Aburatani H., Asai K., Akiyama Y.
Submitted (JUL-2001) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
[3]"The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment."
Clark H.F., Gurney A.L., Abaya E., Baker K., Baldwin D.T., Brush J., Chen J., Chow B., Chui C., Crowley C., Currell B., Deuel B., Dowd P., Eaton D., Foster J.S., Grimaldi C., Gu Q., Hass P.E. expand/collapse author list , Heldens S., Huang A., Kim H.S., Klimowski L., Jin Y., Johnson S., Lee J., Lewis L., Liao D., Mark M.R., Robbie E., Sanchez C., Schoenfeld J., Seshagiri S., Simmons L., Singh J., Smith V., Stinson J., Vagts A., Vandlen R.L., Watanabe C., Wieand D., Woods K., Xie M.-H., Yansura D.G., Yi S., Yu G., Yuan J., Zhang M., Zhang Z., Goddard A.D., Wood W.I., Godowski P.J., Gray A.M.
Genome Res. 13:2265-2270(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), VARIANT THR-404.
[4]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
Tissue: Cerebellum.
[5]"Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H. expand/collapse author list , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[6]"Identification of G protein-coupled receptor genes from the human genome sequence."
Takeda S., Kadowaki S., Haga T., Takaesu H., Mitaku S.
FEBS Lett. 520:97-101(2002) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA] OF 563-1079.
[7]"The G protein-coupled receptor repertoires of human and mouse."
Vassilatis D.K., Hohmann J.G., Zeng H., Li F., Ranchalis J.E., Mortrud M.T., Brown A., Rodriguez S.S., Weller J.R., Wright A.C., Bergmann J.E., Gaitanaris G.A.
Proc. Natl. Acad. Sci. U.S.A. 100:4903-4908(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 797-942.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AY140955 mRNA. Translation: AAN46669.1.
AB065959 Genomic DNA. Translation: BAC45265.1. Sequence problems.
AY358172 mRNA. Translation: AAQ88539.1.
AY358214 Transcribed RNA. Translation: AAQ88581.1.
AB083619 Genomic DNA. Translation: BAB89332.1. Different initiation.
AK293887 mRNA. Translation: BAG57276.1.
AC010896 Genomic DNA. Translation: AAY14645.1.
AY255611 mRNA. Translation: AAO85123.1.
CCDSCCDS33159.2. [Q8IZF5-2]
CCDS46238.1. [Q8IZF5-3]
CCDS46239.1. [Q8IZF5-1]
RefSeqNP_001138640.1. NM_001145168.1. [Q8IZF5-1]
NP_001138641.1. NM_001145169.1. [Q8IZF5-3]
NP_722577.2. NM_153835.3. [Q8IZF5-2]
UniGeneHs.631878.

3D structure databases

ProteinModelPortalQ8IZF5.
SMRQ8IZF5. Positions 431-758.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid127907. 2 interactions.

Protein family/group databases

MEROPSS63.031.
GPCRDBSearch...

PTM databases

PhosphoSiteQ8IZF5.

Polymorphism databases

DMDM59797951.

Proteomic databases

MaxQBQ8IZF5.
PaxDbQ8IZF5.
PRIDEQ8IZF5.

Protocols and materials databases

DNASU165082.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000311519; ENSP00000307831; ENSG00000173567. [Q8IZF5-1]
ENST00000333478; ENSP00000327396; ENSG00000173567. [Q8IZF5-2]
ENST00000421160; ENSP00000388537; ENSG00000173567. [Q8IZF5-3]
ENST00000447444; ENSP00000404775; ENSG00000173567. [Q8IZF5-2]
GeneID165082.
KEGGhsa:165082.
UCSCuc002rhe.4. human. [Q8IZF5-1]
uc010eyk.1. human. [Q8IZF5-2]

Organism-specific databases

CTD165082.
GeneCardsGC02M026444.
HGNCHGNC:18989. GPR113.
HPAHPA044500.
neXtProtNX_Q8IZF5.
PharmGKBPA134918027.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG257112.
HOGENOMHOG000112763.
HOVERGENHBG051770.
InParanoidQ8IZF5.
KOK08456.
OMAGFQLSCC.
OrthoDBEOG7R830V.
PhylomeDBQ8IZF5.
TreeFamTF316380.

Gene expression databases

ArrayExpressQ8IZF5.
BgeeQ8IZF5.
CleanExHS_GPR113.
GenevestigatorQ8IZF5.

Family and domain databases

InterProIPR022624. DUF3497.
IPR017981. GPCR_2-like.
IPR001879. GPCR_2_extracellular_dom.
IPR000832. GPCR_2_secretin-like.
IPR017983. GPCR_2_secretin-like_CS.
IPR000203. GPS.
[Graphical view]
PfamPF00002. 7tm_2. 1 hit.
PF12003. DUF3497. 1 hit.
PF01825. GPS. 1 hit.
PF02793. HRM. 1 hit.
[Graphical view]
PRINTSPR00249. GPCRSECRETIN.
SMARTSM00303. GPS. 1 hit.
[Graphical view]
PROSITEPS00650. G_PROTEIN_RECEP_F2_2. 1 hit.
PS50227. G_PROTEIN_RECEP_F2_3. 1 hit.
PS50261. G_PROTEIN_RECEP_F2_4. 1 hit.
PS50221. GPS. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

GeneWikiGPR113.
GenomeRNAi165082.
NextBio88517.
PROQ8IZF5.

Entry information

Entry nameGP113_HUMAN
AccessionPrimary (citable) accession number: Q8IZF5
Secondary accession number(s): B4DF15 expand/collapse secondary AC list , E9PEV1, Q53TA5, Q6UXT7, Q6UXX3, Q86SL7, Q8IXD8, Q8TDT3
Entry history
Integrated into UniProtKB/Swiss-Prot: February 15, 2005
Last sequence update: March 1, 2003
Last modified: July 9, 2014
This is version 107 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 2

Human chromosome 2: entries, gene names and cross-references to MIM

7-transmembrane G-linked receptors

List of 7-transmembrane G-linked receptor entries