Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q8IZF5

- GP113_HUMAN

UniProt

Q8IZF5 - GP113_HUMAN

Protein

Probable G-protein coupled receptor 113

Gene

GPR113

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 4 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 108 (01 Oct 2014)
      Sequence version 1 (01 Mar 2003)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Orphan receptor.

    GO - Molecular functioni

    1. G-protein coupled receptor activity Source: GDB

    GO - Biological processi

    1. G-protein coupled receptor signaling pathway Source: GDB
    2. neuropeptide signaling pathway Source: InterPro

    Keywords - Molecular functioni

    G-protein coupled receptor, Receptor, Transducer

    Protein family/group databases

    MEROPSiS63.031.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Probable G-protein coupled receptor 113
    Alternative name(s):
    G-protein coupled receptor PGR23
    Gene namesi
    Name:GPR113
    Synonyms:PGR23
    ORF Names:UNQ9196/PRO34000
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 2

    Organism-specific databases

    HGNCiHGNC:18989. GPR113.

    Subcellular locationi

    GO - Cellular componenti

    1. integral component of membrane Source: GDB
    2. plasma membrane Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Cell membrane, Membrane

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA134918027.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Signal peptidei1 – 2525Sequence AnalysisAdd
    BLAST
    Chaini26 – 10791054Probable G-protein coupled receptor 113PRO_0000012893Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Glycosylationi188 – 1881N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi264 – 2641N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi301 – 3011N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi382 – 3821N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi441 – 4411N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi648 – 6481N-linked (GlcNAc...)Sequence Analysis

    Keywords - PTMi

    Glycoprotein

    Proteomic databases

    MaxQBiQ8IZF5.
    PaxDbiQ8IZF5.
    PRIDEiQ8IZF5.

    PTM databases

    PhosphoSiteiQ8IZF5.

    Expressioni

    Gene expression databases

    ArrayExpressiQ8IZF5.
    BgeeiQ8IZF5.
    CleanExiHS_GPR113.
    GenevestigatoriQ8IZF5.

    Organism-specific databases

    HPAiHPA044500.

    Interactioni

    Protein-protein interaction databases

    BioGridi127907. 2 interactions.

    Structurei

    3D structure databases

    ProteinModelPortaliQ8IZF5.
    SMRiQ8IZF5. Positions 431-758.
    ModBaseiSearch...
    MobiDBiSearch...

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini26 – 775750ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini797 – 81115CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini833 – 85119ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini875 – 8817CytoplasmicSequence Analysis
    Topological domaini903 – 92826ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini950 – 97324CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini995 – 10028ExtracellularSequence Analysis
    Topological domaini1024 – 107956CytoplasmicSequence AnalysisAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei776 – 79621Helical; Name=1Sequence AnalysisAdd
    BLAST
    Transmembranei812 – 83221Helical; Name=2Sequence AnalysisAdd
    BLAST
    Transmembranei852 – 87423Helical; Name=3Sequence AnalysisAdd
    BLAST
    Transmembranei882 – 90221Helical; Name=4Sequence AnalysisAdd
    BLAST
    Transmembranei929 – 94921Helical; Name=5Sequence AnalysisAdd
    BLAST
    Transmembranei974 – 99421Helical; Name=6Sequence AnalysisAdd
    BLAST
    Transmembranei1003 – 102321Helical; Name=7Sequence AnalysisAdd
    BLAST

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini712 – 76453GPSPROSITE-ProRule annotationAdd
    BLAST

    Sequence similaritiesi

    Contains 1 GPS domain.PROSITE-ProRule annotation

    Keywords - Domaini

    Signal, Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiNOG257112.
    HOGENOMiHOG000112763.
    HOVERGENiHBG051770.
    InParanoidiQ8IZF5.
    KOiK08456.
    OMAiGFQLSCC.
    OrthoDBiEOG7R830V.
    PhylomeDBiQ8IZF5.
    TreeFamiTF316380.

    Family and domain databases

    InterProiIPR022624. DUF3497.
    IPR017981. GPCR_2-like.
    IPR001879. GPCR_2_extracellular_dom.
    IPR000832. GPCR_2_secretin-like.
    IPR017983. GPCR_2_secretin-like_CS.
    IPR000203. GPS.
    [Graphical view]
    PfamiPF00002. 7tm_2. 1 hit.
    PF12003. DUF3497. 1 hit.
    PF01825. GPS. 1 hit.
    PF02793. HRM. 1 hit.
    [Graphical view]
    PRINTSiPR00249. GPCRSECRETIN.
    SMARTiSM00303. GPS. 1 hit.
    [Graphical view]
    PROSITEiPS00650. G_PROTEIN_RECEP_F2_2. 1 hit.
    PS50227. G_PROTEIN_RECEP_F2_3. 1 hit.
    PS50261. G_PROTEIN_RECEP_F2_4. 1 hit.
    PS50221. GPS. 1 hit.
    [Graphical view]

    Sequences (3)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q8IZF5-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MVCSAAPLLL LATTLPLLGS PVAQASQPVS ETGVRPREGL QRRQWGPLIG     50
    RDKAWNERID RPFPACPIPL SSSFGRWPKG QTMWAQTSTL TLTEEELGQS 100
    QAGGESGSGQ LLDQENGAGE SALVSVYVHL DFPDKTWPPE LSRTLTLPAA 150
    SASSSPRPLL TGLRLTTECN VNHKGNFYCA CLSGYQWNTS ICLHYPPCQS 200
    LHNHQPCGCL VFSHPEPGYC QLLPPGSPVT CLPAVPGILN LNSQLQMPGD 250
    TLSLTLHLSQ EATNLSWFLR HPGSPSPILL QPGTQVSVTS SHGQAALSVS 300
    NMSHHWAGEY MSCFEAQGFK WNLYEVVRVP LKATDVARLP YQLSISCATS 350
    PGFQLSCCIP STNLAYTAAW SPGEGSKASS FNESGSQCFV LAVQRCPMAD 400
    TTYACDLQSL GLAPLRVPIS ITIIQDGDIT CPEDASVLTW NVTKAGHVAQ 450
    APCPESKRGI VRRLCGADGV WGPVHSSCTD ARLLALFTRT KLLQAGQGSP 500
    AEEVPQILAQ LPGQAAEASS PSDLLTLLST MKYVAKVVAE ARIQLDRRAL 550
    KNLLIATDKV LDMDTRSLWT LAQARKPWAG STLLLAVETL ACSLCPQDHP 600
    FAFSLPNVLL QSQLFGPTFP ADYSISFPTR PPLQAQIPRH SLAPLVRNGT 650
    EISITSLVLR KLDHLLPSNY GQGLGDSLYA TPGLVLVISI MAGDRAFSQG 700
    EVIMDFGNTD GSPHCVFWDH SLFQGRGGWS KEGCQAQVAS ASPTAQCLCQ 750
    HLTAFSVLMS PHTVPEEPAL ALLTQVGLGA SILALLVCLG VYWLVWRVVV 800
    RNKISYFRHA ALLNMVFCLL AADTCFLGAP FLSPGPRSPL CLAAAFLCHF 850
    LYLATFFWML AQALVLAHQL LFVFHQLAKH RVLPLMVLLG YLCPLGLAGV 900
    TLGLYLPQGQ YLREGECWLD GKGGALYTFV GPVLAIIGVN GLVLAMAMLK 950
    LLRPSLSEGP PAEKRQALLG VIKALLILTP IFGLTWGLGL ATLLEEVSTV 1000
    PHYIFTILNT LQGVFILLFG CLMDRKIQEA LRKRFCRAQA PSSTISLVSC 1050
    CLQILSCASK SMSEGIPWPS SEDMGTARS 1079
    Length:1,079
    Mass (Da):116,341
    Last modified:March 1, 2003 - v1
    Checksum:iA18CA158F4DDBB9C
    GO
    Isoform 2 (identifier: Q8IZF5-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-97: MVCSAAPLLL...STLTLTEEEL → MTTRKLSAHS...RMAKTGLPEK
         168-307: Missing.
         1048-1079: VSCCLQILSCASKSMSEGIPWPSSEDMGTARS → ATNEGCILEHSKGGSDTARKTDASE

    Show »
    Length:873
    Mass (Da):93,912
    Checksum:i03A8E3E3AEEDE1C8
    GO
    Isoform 3 (identifier: Q8IZF5-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         29-97: Missing.
         1048-1079: VSCCLQILSCASKSMSEGIPWPSSEDMGTARS → ATNEGCILEHSKGGSDTAR

    Note: No experimental confirmation available.

    Show »
    Length:997
    Mass (Da):107,020
    Checksum:i3319FE1B2BBDB3B3
    GO

    Sequence cautioni

    The sequence BAB89332.1 differs from that shown. Reason: Erroneous initiation.
    The sequence BAC45265.1 differs from that shown. Reason: Erroneous gene model prediction.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti348 – 3481A → V in AAQ88539. (PubMed:12975309)Curated
    Sequence conflicti599 – 5991H → Y in AAQ88539. (PubMed:12975309)Curated
    Sequence conflicti765 – 7651P → S in BAG57276. (PubMed:14702039)Curated
    Sequence conflicti886 – 8861M → T in AAQ88581. (PubMed:12975309)Curated
    Isoform 2 (identifier: Q8IZF5-2)
    Sequence conflicti868 – 8681K → N in AAQ88581. (PubMed:12975309)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti404 – 4041A → T.1 Publication
    Corresponds to variant rs2052937 [ dbSNP | Ensembl ].
    VAR_024475

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 9797MVCSA…TEEEL → MTTRKLSAHSAATPGYKAVT HKHHTGWARMAKTGLPEK in isoform 2. 1 PublicationVSP_012815Add
    BLAST
    Alternative sequencei29 – 9769Missing in isoform 3. 1 PublicationVSP_046174Add
    BLAST
    Alternative sequencei168 – 307140Missing in isoform 2. 1 PublicationVSP_012816Add
    BLAST
    Alternative sequencei1048 – 107932VSCCL…GTARS → ATNEGCILEHSKGGSDTARK TDASE in isoform 2. 1 PublicationVSP_012817Add
    BLAST
    Alternative sequencei1048 – 107932VSCCL…GTARS → ATNEGCILEHSKGGSDTAR in isoform 3. 1 PublicationVSP_046175Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AY140955 mRNA. Translation: AAN46669.1.
    AB065959 Genomic DNA. Translation: BAC45265.1. Sequence problems.
    AY358172 mRNA. Translation: AAQ88539.1.
    AY358214 Transcribed RNA. Translation: AAQ88581.1.
    AB083619 Genomic DNA. Translation: BAB89332.1. Different initiation.
    AK293887 mRNA. Translation: BAG57276.1.
    AC010896 Genomic DNA. Translation: AAY14645.1.
    AY255611 mRNA. Translation: AAO85123.1.
    CCDSiCCDS33159.2. [Q8IZF5-2]
    CCDS46238.1. [Q8IZF5-3]
    CCDS46239.1. [Q8IZF5-1]
    RefSeqiNP_001138640.1. NM_001145168.1. [Q8IZF5-1]
    NP_001138641.1. NM_001145169.1. [Q8IZF5-3]
    NP_722577.2. NM_153835.3. [Q8IZF5-2]
    UniGeneiHs.631878.

    Genome annotation databases

    EnsembliENST00000311519; ENSP00000307831; ENSG00000173567. [Q8IZF5-1]
    ENST00000333478; ENSP00000327396; ENSG00000173567. [Q8IZF5-2]
    ENST00000421160; ENSP00000388537; ENSG00000173567. [Q8IZF5-3]
    ENST00000447444; ENSP00000404775; ENSG00000173567. [Q8IZF5-2]
    GeneIDi165082.
    KEGGihsa:165082.
    UCSCiuc002rhe.4. human. [Q8IZF5-1]
    uc010eyk.1. human. [Q8IZF5-2]

    Polymorphism databases

    DMDMi59797951.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AY140955 mRNA. Translation: AAN46669.1 .
    AB065959 Genomic DNA. Translation: BAC45265.1 . Sequence problems.
    AY358172 mRNA. Translation: AAQ88539.1 .
    AY358214 Transcribed RNA. Translation: AAQ88581.1 .
    AB083619 Genomic DNA. Translation: BAB89332.1 . Different initiation.
    AK293887 mRNA. Translation: BAG57276.1 .
    AC010896 Genomic DNA. Translation: AAY14645.1 .
    AY255611 mRNA. Translation: AAO85123.1 .
    CCDSi CCDS33159.2. [Q8IZF5-2 ]
    CCDS46238.1. [Q8IZF5-3 ]
    CCDS46239.1. [Q8IZF5-1 ]
    RefSeqi NP_001138640.1. NM_001145168.1. [Q8IZF5-1 ]
    NP_001138641.1. NM_001145169.1. [Q8IZF5-3 ]
    NP_722577.2. NM_153835.3. [Q8IZF5-2 ]
    UniGenei Hs.631878.

    3D structure databases

    ProteinModelPortali Q8IZF5.
    SMRi Q8IZF5. Positions 431-758.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 127907. 2 interactions.

    Protein family/group databases

    MEROPSi S63.031.
    GPCRDBi Search...

    PTM databases

    PhosphoSitei Q8IZF5.

    Polymorphism databases

    DMDMi 59797951.

    Proteomic databases

    MaxQBi Q8IZF5.
    PaxDbi Q8IZF5.
    PRIDEi Q8IZF5.

    Protocols and materials databases

    DNASUi 165082.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000311519 ; ENSP00000307831 ; ENSG00000173567 . [Q8IZF5-1 ]
    ENST00000333478 ; ENSP00000327396 ; ENSG00000173567 . [Q8IZF5-2 ]
    ENST00000421160 ; ENSP00000388537 ; ENSG00000173567 . [Q8IZF5-3 ]
    ENST00000447444 ; ENSP00000404775 ; ENSG00000173567 . [Q8IZF5-2 ]
    GeneIDi 165082.
    KEGGi hsa:165082.
    UCSCi uc002rhe.4. human. [Q8IZF5-1 ]
    uc010eyk.1. human. [Q8IZF5-2 ]

    Organism-specific databases

    CTDi 165082.
    GeneCardsi GC02M026444.
    HGNCi HGNC:18989. GPR113.
    HPAi HPA044500.
    neXtProti NX_Q8IZF5.
    PharmGKBi PA134918027.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG257112.
    HOGENOMi HOG000112763.
    HOVERGENi HBG051770.
    InParanoidi Q8IZF5.
    KOi K08456.
    OMAi GFQLSCC.
    OrthoDBi EOG7R830V.
    PhylomeDBi Q8IZF5.
    TreeFami TF316380.

    Miscellaneous databases

    GeneWikii GPR113.
    GenomeRNAii 165082.
    NextBioi 88517.
    PROi Q8IZF5.

    Gene expression databases

    ArrayExpressi Q8IZF5.
    Bgeei Q8IZF5.
    CleanExi HS_GPR113.
    Genevestigatori Q8IZF5.

    Family and domain databases

    InterProi IPR022624. DUF3497.
    IPR017981. GPCR_2-like.
    IPR001879. GPCR_2_extracellular_dom.
    IPR000832. GPCR_2_secretin-like.
    IPR017983. GPCR_2_secretin-like_CS.
    IPR000203. GPS.
    [Graphical view ]
    Pfami PF00002. 7tm_2. 1 hit.
    PF12003. DUF3497. 1 hit.
    PF01825. GPS. 1 hit.
    PF02793. HRM. 1 hit.
    [Graphical view ]
    PRINTSi PR00249. GPCRSECRETIN.
    SMARTi SM00303. GPS. 1 hit.
    [Graphical view ]
    PROSITEi PS00650. G_PROTEIN_RECEP_F2_2. 1 hit.
    PS50227. G_PROTEIN_RECEP_F2_3. 1 hit.
    PS50261. G_PROTEIN_RECEP_F2_4. 1 hit.
    PS50221. GPS. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Novel human G protein-coupled receptors with long N-terminals containing GPS domains and Ser/Thr-rich regions."
      Fredriksson R., Lagerstroem M.C., Hoeglund P.J., Schioeth H.B.
      FEBS Lett. 531:407-414(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    2. "Genome-wide discovery and analysis of human seven transmembrane helix receptor genes."
      Suwa M., Sato T., Okouchi I., Arita M., Futami K., Matsumoto S., Tsutsumi S., Aburatani H., Asai K., Akiyama Y.
      Submitted (JUL-2001) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
    3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), VARIANT THR-404.
    4. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
      Tissue: Cerebellum.
    5. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
      Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
      , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
      Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    6. "Identification of G protein-coupled receptor genes from the human genome sequence."
      Takeda S., Kadowaki S., Haga T., Takaesu H., Mitaku S.
      FEBS Lett. 520:97-101(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA] OF 563-1079.
    7. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 797-942.

    Entry informationi

    Entry nameiGP113_HUMAN
    AccessioniPrimary (citable) accession number: Q8IZF5
    Secondary accession number(s): B4DF15
    , E9PEV1, Q53TA5, Q6UXT7, Q6UXX3, Q86SL7, Q8IXD8, Q8TDT3
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: February 15, 2005
    Last sequence update: March 1, 2003
    Last modified: October 1, 2014
    This is version 108 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. 7-transmembrane G-linked receptors
      List of 7-transmembrane G-linked receptor entries
    2. Human chromosome 2
      Human chromosome 2: entries, gene names and cross-references to MIM
    3. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    4. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3