Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q8IZF5

- GP113_HUMAN

UniProt

Q8IZF5 - GP113_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Probable G-protein coupled receptor 113

Gene

GPR113

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 4 out of 5- Experimental evidence at transcript leveli

Functioni

Orphan receptor.

GO - Molecular functioni

  1. G-protein coupled receptor activity Source: GDB

GO - Biological processi

  1. G-protein coupled receptor signaling pathway Source: GDB
  2. neuropeptide signaling pathway Source: InterPro
Complete GO annotation...

Keywords - Molecular functioni

G-protein coupled receptor, Receptor, Transducer

Protein family/group databases

MEROPSiS63.031.

Names & Taxonomyi

Protein namesi
Recommended name:
Probable G-protein coupled receptor 113
Alternative name(s):
G-protein coupled receptor PGR23
Gene namesi
Name:GPR113
Synonyms:PGR23
ORF Names:UNQ9196/PRO34000
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 2

Organism-specific databases

HGNCiHGNC:18989. GPR113.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini26 – 775750ExtracellularSequence AnalysisAdd
BLAST
Transmembranei776 – 79621Helical; Name=1Sequence AnalysisAdd
BLAST
Topological domaini797 – 81115CytoplasmicSequence AnalysisAdd
BLAST
Transmembranei812 – 83221Helical; Name=2Sequence AnalysisAdd
BLAST
Topological domaini833 – 85119ExtracellularSequence AnalysisAdd
BLAST
Transmembranei852 – 87423Helical; Name=3Sequence AnalysisAdd
BLAST
Topological domaini875 – 8817CytoplasmicSequence Analysis
Transmembranei882 – 90221Helical; Name=4Sequence AnalysisAdd
BLAST
Topological domaini903 – 92826ExtracellularSequence AnalysisAdd
BLAST
Transmembranei929 – 94921Helical; Name=5Sequence AnalysisAdd
BLAST
Topological domaini950 – 97324CytoplasmicSequence AnalysisAdd
BLAST
Transmembranei974 – 99421Helical; Name=6Sequence AnalysisAdd
BLAST
Topological domaini995 – 10028ExtracellularSequence Analysis
Transmembranei1003 – 102321Helical; Name=7Sequence AnalysisAdd
BLAST
Topological domaini1024 – 107956CytoplasmicSequence AnalysisAdd
BLAST

GO - Cellular componenti

  1. integral component of membrane Source: GDB
  2. plasma membrane Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134918027.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 2525Sequence AnalysisAdd
BLAST
Chaini26 – 10791054Probable G-protein coupled receptor 113PRO_0000012893Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi188 – 1881N-linked (GlcNAc...)Sequence Analysis
Glycosylationi264 – 2641N-linked (GlcNAc...)Sequence Analysis
Glycosylationi301 – 3011N-linked (GlcNAc...)Sequence Analysis
Glycosylationi382 – 3821N-linked (GlcNAc...)Sequence Analysis
Glycosylationi441 – 4411N-linked (GlcNAc...)Sequence Analysis
Glycosylationi648 – 6481N-linked (GlcNAc...)Sequence Analysis

Keywords - PTMi

Glycoprotein

Proteomic databases

MaxQBiQ8IZF5.
PaxDbiQ8IZF5.
PRIDEiQ8IZF5.

PTM databases

PhosphoSiteiQ8IZF5.

Expressioni

Gene expression databases

BgeeiQ8IZF5.
CleanExiHS_GPR113.
ExpressionAtlasiQ8IZF5. baseline and differential.
GenevestigatoriQ8IZF5.

Organism-specific databases

HPAiHPA044500.

Interactioni

Protein-protein interaction databases

BioGridi127907. 2 interactions.

Structurei

3D structure databases

ProteinModelPortaliQ8IZF5.
SMRiQ8IZF5. Positions 431-758.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini712 – 76453GPSPROSITE-ProRule annotationAdd
BLAST

Sequence similaritiesi

Contains 1 GPS domain.PROSITE-ProRule annotation

Keywords - Domaini

Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG257112.
GeneTreeiENSGT00770000120478.
HOGENOMiHOG000112763.
HOVERGENiHBG051770.
InParanoidiQ8IZF5.
KOiK08456.
OMAiGFQLSCC.
OrthoDBiEOG7R830V.
PhylomeDBiQ8IZF5.
TreeFamiTF316380.

Family and domain databases

InterProiIPR022624. DUF3497.
IPR017981. GPCR_2-like.
IPR001879. GPCR_2_extracellular_dom.
IPR000832. GPCR_2_secretin-like.
IPR017983. GPCR_2_secretin-like_CS.
IPR000203. GPS.
[Graphical view]
PfamiPF00002. 7tm_2. 1 hit.
PF12003. DUF3497. 1 hit.
PF01825. GPS. 1 hit.
PF02793. HRM. 1 hit.
[Graphical view]
PRINTSiPR00249. GPCRSECRETIN.
SMARTiSM00303. GPS. 1 hit.
[Graphical view]
PROSITEiPS00650. G_PROTEIN_RECEP_F2_2. 1 hit.
PS50227. G_PROTEIN_RECEP_F2_3. 1 hit.
PS50261. G_PROTEIN_RECEP_F2_4. 1 hit.
PS50221. GPS. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q8IZF5-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MVCSAAPLLL LATTLPLLGS PVAQASQPVS ETGVRPREGL QRRQWGPLIG
60 70 80 90 100
RDKAWNERID RPFPACPIPL SSSFGRWPKG QTMWAQTSTL TLTEEELGQS
110 120 130 140 150
QAGGESGSGQ LLDQENGAGE SALVSVYVHL DFPDKTWPPE LSRTLTLPAA
160 170 180 190 200
SASSSPRPLL TGLRLTTECN VNHKGNFYCA CLSGYQWNTS ICLHYPPCQS
210 220 230 240 250
LHNHQPCGCL VFSHPEPGYC QLLPPGSPVT CLPAVPGILN LNSQLQMPGD
260 270 280 290 300
TLSLTLHLSQ EATNLSWFLR HPGSPSPILL QPGTQVSVTS SHGQAALSVS
310 320 330 340 350
NMSHHWAGEY MSCFEAQGFK WNLYEVVRVP LKATDVARLP YQLSISCATS
360 370 380 390 400
PGFQLSCCIP STNLAYTAAW SPGEGSKASS FNESGSQCFV LAVQRCPMAD
410 420 430 440 450
TTYACDLQSL GLAPLRVPIS ITIIQDGDIT CPEDASVLTW NVTKAGHVAQ
460 470 480 490 500
APCPESKRGI VRRLCGADGV WGPVHSSCTD ARLLALFTRT KLLQAGQGSP
510 520 530 540 550
AEEVPQILAQ LPGQAAEASS PSDLLTLLST MKYVAKVVAE ARIQLDRRAL
560 570 580 590 600
KNLLIATDKV LDMDTRSLWT LAQARKPWAG STLLLAVETL ACSLCPQDHP
610 620 630 640 650
FAFSLPNVLL QSQLFGPTFP ADYSISFPTR PPLQAQIPRH SLAPLVRNGT
660 670 680 690 700
EISITSLVLR KLDHLLPSNY GQGLGDSLYA TPGLVLVISI MAGDRAFSQG
710 720 730 740 750
EVIMDFGNTD GSPHCVFWDH SLFQGRGGWS KEGCQAQVAS ASPTAQCLCQ
760 770 780 790 800
HLTAFSVLMS PHTVPEEPAL ALLTQVGLGA SILALLVCLG VYWLVWRVVV
810 820 830 840 850
RNKISYFRHA ALLNMVFCLL AADTCFLGAP FLSPGPRSPL CLAAAFLCHF
860 870 880 890 900
LYLATFFWML AQALVLAHQL LFVFHQLAKH RVLPLMVLLG YLCPLGLAGV
910 920 930 940 950
TLGLYLPQGQ YLREGECWLD GKGGALYTFV GPVLAIIGVN GLVLAMAMLK
960 970 980 990 1000
LLRPSLSEGP PAEKRQALLG VIKALLILTP IFGLTWGLGL ATLLEEVSTV
1010 1020 1030 1040 1050
PHYIFTILNT LQGVFILLFG CLMDRKIQEA LRKRFCRAQA PSSTISLVSC
1060 1070
CLQILSCASK SMSEGIPWPS SEDMGTARS
Length:1,079
Mass (Da):116,341
Last modified:March 1, 2003 - v1
Checksum:iA18CA158F4DDBB9C
GO
Isoform 2 (identifier: Q8IZF5-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-97: MVCSAAPLLL...STLTLTEEEL → MTTRKLSAHS...RMAKTGLPEK
     168-307: Missing.
     1048-1079: VSCCLQILSCASKSMSEGIPWPSSEDMGTARS → ATNEGCILEHSKGGSDTARKTDASE

Show »
Length:873
Mass (Da):93,912
Checksum:i03A8E3E3AEEDE1C8
GO
Isoform 3 (identifier: Q8IZF5-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     29-97: Missing.
     1048-1079: VSCCLQILSCASKSMSEGIPWPSSEDMGTARS → ATNEGCILEHSKGGSDTAR

Note: No experimental confirmation available.

Show »
Length:997
Mass (Da):107,020
Checksum:i3319FE1B2BBDB3B3
GO

Sequence cautioni

The sequence BAB89332.1 differs from that shown. Reason: Erroneous initiation. Curated
The sequence BAC45265.1 differs from that shown. Reason: Erroneous gene model prediction. Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti348 – 3481A → V in AAQ88539. (PubMed:12975309)Curated
Sequence conflicti599 – 5991H → Y in AAQ88539. (PubMed:12975309)Curated
Sequence conflicti765 – 7651P → S in BAG57276. (PubMed:14702039)Curated
Sequence conflicti886 – 8861M → T in AAQ88581. (PubMed:12975309)Curated
Isoform 2 (identifier: Q8IZF5-2)
Sequence conflicti868 – 8681K → N in AAQ88581. (PubMed:12975309)Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti404 – 4041A → T.1 Publication
Corresponds to variant rs2052937 [ dbSNP | Ensembl ].
VAR_024475

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 9797MVCSA…TEEEL → MTTRKLSAHSAATPGYKAVT HKHHTGWARMAKTGLPEK in isoform 2. 1 PublicationVSP_012815Add
BLAST
Alternative sequencei29 – 9769Missing in isoform 3. 1 PublicationVSP_046174Add
BLAST
Alternative sequencei168 – 307140Missing in isoform 2. 1 PublicationVSP_012816Add
BLAST
Alternative sequencei1048 – 107932VSCCL…GTARS → ATNEGCILEHSKGGSDTARK TDASE in isoform 2. 1 PublicationVSP_012817Add
BLAST
Alternative sequencei1048 – 107932VSCCL…GTARS → ATNEGCILEHSKGGSDTAR in isoform 3. 1 PublicationVSP_046175Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY140955 mRNA. Translation: AAN46669.1.
AB065959 Genomic DNA. Translation: BAC45265.1. Sequence problems.
AY358172 mRNA. Translation: AAQ88539.1.
AY358214 Transcribed RNA. Translation: AAQ88581.1.
AB083619 Genomic DNA. Translation: BAB89332.1. Different initiation.
AK293887 mRNA. Translation: BAG57276.1.
AC010896 Genomic DNA. Translation: AAY14645.1.
AY255611 mRNA. Translation: AAO85123.1.
CCDSiCCDS33159.2. [Q8IZF5-2]
CCDS46238.1. [Q8IZF5-3]
CCDS46239.1. [Q8IZF5-1]
RefSeqiNP_001138640.1. NM_001145168.1. [Q8IZF5-1]
NP_001138641.1. NM_001145169.1. [Q8IZF5-3]
NP_722577.2. NM_153835.3. [Q8IZF5-2]
UniGeneiHs.631878.

Genome annotation databases

EnsembliENST00000311519; ENSP00000307831; ENSG00000173567. [Q8IZF5-1]
ENST00000333478; ENSP00000327396; ENSG00000173567. [Q8IZF5-2]
ENST00000421160; ENSP00000388537; ENSG00000173567. [Q8IZF5-3]
ENST00000447444; ENSP00000404775; ENSG00000173567. [Q8IZF5-2]
GeneIDi165082.
KEGGihsa:165082.
UCSCiuc002rhe.4. human. [Q8IZF5-1]
uc010eyk.1. human. [Q8IZF5-2]

Polymorphism databases

DMDMi59797951.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY140955 mRNA. Translation: AAN46669.1 .
AB065959 Genomic DNA. Translation: BAC45265.1 . Sequence problems.
AY358172 mRNA. Translation: AAQ88539.1 .
AY358214 Transcribed RNA. Translation: AAQ88581.1 .
AB083619 Genomic DNA. Translation: BAB89332.1 . Different initiation.
AK293887 mRNA. Translation: BAG57276.1 .
AC010896 Genomic DNA. Translation: AAY14645.1 .
AY255611 mRNA. Translation: AAO85123.1 .
CCDSi CCDS33159.2. [Q8IZF5-2 ]
CCDS46238.1. [Q8IZF5-3 ]
CCDS46239.1. [Q8IZF5-1 ]
RefSeqi NP_001138640.1. NM_001145168.1. [Q8IZF5-1 ]
NP_001138641.1. NM_001145169.1. [Q8IZF5-3 ]
NP_722577.2. NM_153835.3. [Q8IZF5-2 ]
UniGenei Hs.631878.

3D structure databases

ProteinModelPortali Q8IZF5.
SMRi Q8IZF5. Positions 431-758.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 127907. 2 interactions.

Protein family/group databases

MEROPSi S63.031.
GPCRDBi Search...

PTM databases

PhosphoSitei Q8IZF5.

Polymorphism databases

DMDMi 59797951.

Proteomic databases

MaxQBi Q8IZF5.
PaxDbi Q8IZF5.
PRIDEi Q8IZF5.

Protocols and materials databases

DNASUi 165082.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000311519 ; ENSP00000307831 ; ENSG00000173567 . [Q8IZF5-1 ]
ENST00000333478 ; ENSP00000327396 ; ENSG00000173567 . [Q8IZF5-2 ]
ENST00000421160 ; ENSP00000388537 ; ENSG00000173567 . [Q8IZF5-3 ]
ENST00000447444 ; ENSP00000404775 ; ENSG00000173567 . [Q8IZF5-2 ]
GeneIDi 165082.
KEGGi hsa:165082.
UCSCi uc002rhe.4. human. [Q8IZF5-1 ]
uc010eyk.1. human. [Q8IZF5-2 ]

Organism-specific databases

CTDi 165082.
GeneCardsi GC02M026531.
HGNCi HGNC:18989. GPR113.
HPAi HPA044500.
neXtProti NX_Q8IZF5.
PharmGKBi PA134918027.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG257112.
GeneTreei ENSGT00770000120478.
HOGENOMi HOG000112763.
HOVERGENi HBG051770.
InParanoidi Q8IZF5.
KOi K08456.
OMAi GFQLSCC.
OrthoDBi EOG7R830V.
PhylomeDBi Q8IZF5.
TreeFami TF316380.

Miscellaneous databases

GeneWikii GPR113.
GenomeRNAii 165082.
NextBioi 88517.
PROi Q8IZF5.

Gene expression databases

Bgeei Q8IZF5.
CleanExi HS_GPR113.
ExpressionAtlasi Q8IZF5. baseline and differential.
Genevestigatori Q8IZF5.

Family and domain databases

InterProi IPR022624. DUF3497.
IPR017981. GPCR_2-like.
IPR001879. GPCR_2_extracellular_dom.
IPR000832. GPCR_2_secretin-like.
IPR017983. GPCR_2_secretin-like_CS.
IPR000203. GPS.
[Graphical view ]
Pfami PF00002. 7tm_2. 1 hit.
PF12003. DUF3497. 1 hit.
PF01825. GPS. 1 hit.
PF02793. HRM. 1 hit.
[Graphical view ]
PRINTSi PR00249. GPCRSECRETIN.
SMARTi SM00303. GPS. 1 hit.
[Graphical view ]
PROSITEi PS00650. G_PROTEIN_RECEP_F2_2. 1 hit.
PS50227. G_PROTEIN_RECEP_F2_3. 1 hit.
PS50261. G_PROTEIN_RECEP_F2_4. 1 hit.
PS50221. GPS. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Novel human G protein-coupled receptors with long N-terminals containing GPS domains and Ser/Thr-rich regions."
    Fredriksson R., Lagerstroem M.C., Hoeglund P.J., Schioeth H.B.
    FEBS Lett. 531:407-414(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
  2. "Genome-wide discovery and analysis of human seven transmembrane helix receptor genes."
    Suwa M., Sato T., Okouchi I., Arita M., Futami K., Matsumoto S., Tsutsumi S., Aburatani H., Asai K., Akiyama Y.
    Submitted (JUL-2001) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), VARIANT THR-404.
  4. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
    Tissue: Cerebellum.
  5. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
    Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
    , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
    Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. "Identification of G protein-coupled receptor genes from the human genome sequence."
    Takeda S., Kadowaki S., Haga T., Takaesu H., Mitaku S.
    FEBS Lett. 520:97-101(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA] OF 563-1079.
  7. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 797-942.

Entry informationi

Entry nameiGP113_HUMAN
AccessioniPrimary (citable) accession number: Q8IZF5
Secondary accession number(s): B4DF15
, E9PEV1, Q53TA5, Q6UXT7, Q6UXX3, Q86SL7, Q8IXD8, Q8TDT3
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 15, 2005
Last sequence update: March 1, 2003
Last modified: November 26, 2014
This is version 110 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. 7-transmembrane G-linked receptors
    List of 7-transmembrane G-linked receptor entries
  2. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3