Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q8IZA0 (K319L_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 84. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (6) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Dyslexia-associated protein KIAA0319-like protein
Gene names
Name:KIAA0319L
Synonyms:KIAA1837
ORF Names:PP791
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length1049 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Possible role in axon guidance through interaction with RTN4R. Ref.13

Subunit structure

Interacts with RTN4R. Ref.13

Subcellular location

Cytoplasmic granule membrane; Multi-pass membrane protein Potential Ref.13.

Tissue specificity

Expressed in cortical neurons in the brain cortex (at protein level). Ref.13

Post-translational modification

N-glycosylated. Ref.13

Sequence similarities

Contains 1 MANSC domain.

Contains 5 PKD domains.

Sequence caution

The sequence AAD05028.1 differs from that shown. Reason: Erroneous gene model prediction.

The sequence AAL55781.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

The sequence BAB14874.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

The sequence BAB47466.1 differs from that shown. Reason: Contaminating sequence. Sequence of unknown origin in the N-terminal part.

The sequence CAI22688.1 differs from that shown. Reason: Erroneous gene model prediction.

The sequence CAI23123.1 differs from that shown. Reason: Erroneous gene model prediction.

Ontologies

Binary interactions

With

Entry

#Exp.

IntAct

Notes

RTN4RQ9BZR64EBI-5240269,EBI-5240240

Alternative products

This entry describes 3 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q8IZA0-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q8IZA0-2)

The sequence of this isoform differs from the canonical sequence as follows:
     989-1049: IKQKGLLLSSSLMHSESELDSDDAIFTWPDREKGKLLHGQNGSVPNGQTPLKARSPREEIL → RGPGCQSF
Note: No experimental confirmation available.
Isoform 3 (identifier: Q8IZA0-3)

The sequence of this isoform differs from the canonical sequence as follows:
     1-563: Missing.
     638-638: Q → HFFFCR
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 10491049Dyslexia-associated protein KIAA0319-like protein
PRO_0000329064

Regions

Topological domain1 – 2929Cytoplasmic Potential
Transmembrane30 – 5021Helical; Potential
Topological domain51 – 932882Extracellular Potential
Transmembrane933 – 95321Helical; Potential
Topological domain954 – 104996Cytoplasmic Potential
Domain49 – 12779MANSC
Domain312 – 40190PKD 1
Domain409 – 49890PKD 2
Domain504 – 59491PKD 3
Domain600 – 68889PKD 4
Domain694 – 78592PKD 5

Amino acid modifications

Modified residue10371Phosphothreonine Ref.11
Glycosylation2471N-linked (GlcNAc...) Potential
Glycosylation3951N-linked (GlcNAc...) Potential
Glycosylation4721N-linked (GlcNAc...) Ref.10
Glycosylation4871N-linked (GlcNAc...) Potential
Glycosylation5251N-linked (GlcNAc...) Ref.10

Natural variations

Alternative sequence1 – 563563Missing in isoform 3.
VSP_032953
Alternative sequence6381Q → HFFFCR in isoform 3.
VSP_032954
Alternative sequence989 – 104961IKQKG…REEIL → RGPGCQSF in isoform 2.
VSP_032955
Natural variant2431G → D.
Corresponds to variant rs1635712 [ dbSNP | Ensembl ].
VAR_042644
Natural variant8371Q → H.
Corresponds to variant rs1361040 [ dbSNP | Ensembl ].
VAR_042645

Experimental info

Sequence conflict371C → Y in AAN61054. Ref.1
Sequence conflict371C → Y in AAG24389. Ref.2
Sequence conflict861W → L in AAH14530. Ref.5
Sequence conflict2031H → Y in AAG24389. Ref.2
Sequence conflict5201I → T in AAG24389. Ref.2

Secondary structure

................. 1049
Helix Strand Turn

Details...

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified April 29, 2008. Version 2.
Checksum: FD81BFCA3D38D106

FASTA1,049115,658
        10         20         30         40         50         60 
MEKRLGVKPN PASWILSGYY WQTSAKWLRS LYLFYTCFCF SVLWLSTDAS ESRCQQGKTQ 

        70         80         90        100        110        120 
FGVGLRSGGE NHLWLLEGTP SLQSCWAACC QDSACHVFWW LEGMCIQADC SRPQSCRAFR 

       130        140        150        160        170        180 
THSSNSMLVF LKKFQTADDL GFLPEDDVPH LLGLGWNWAS WRQSPPRAAL RPAVSSSDQQ 

       190        200        210        220        230        240 
SLIRKLQKRG SPSDVVTPIV TQHSKVNDSN ELGGLTTSGS AEVHKAITIS SPLTTDLTAE 

       250        260        270        280        290        300 
LSGGPKNVSV QPEISEGLAT TPSTQQVKSS EKTQIAVPQP VAPSYSYATP TPQASFQSTS 

       310        320        330        340        350        360 
APYPVIKELV VSAGESVQIT LPKNEVQLNA YVLQEPPKGE TYTYDWQLIT HPRDYSGEME 

       370        380        390        400        410        420 
GKHSQILKLS KLTPGLYEFK VIVEGQNAHG EGYVNVTVKP EPRKNRPPIA IVSPQFQEIS 

       430        440        450        460        470        480 
LPTTSTVIDG SQSTDDDKIV QYHWEELKGP LREEKISEDT AILKLSKLVP GNYTFSLTVV 

       490        500        510        520        530        540 
DSDGATNSTT ANLTVNKAVD YPPVANAGPN QVITLPQNSI TLFGNQSTDD HGITSYEWSL 

       550        560        570        580        590        600 
SPSSKGKVVE MQGVRTPTLQ LSAMQEGDYT YQLTVTDTIG QQATAQVTVI VQPENNKPPQ 

       610        620        630        640        650        660 
ADAGPDKELT LPVDSTTLDG SKSSDDQKII SYLWEKTQGP DGVQLENANS SVATVTGLQV 

       670        680        690        700        710        720 
GTYVFTLTVK DERNLQSQSS VNVIVKEEIN KPPIAKITGN VVITLPTSTA ELDGSKSSDD 

       730        740        750        760        770        780 
KGIVSYLWTR DEGSPAAGEV LNHSDHHPIL FLSNLVEGTY TFHLKVTDAK GESDTDRTTV 

       790        800        810        820        830        840 
EVKPDPRKNN LVEIILDINV SQLTERLKGM FIRQIGVLLG VLDSDIIVQK IQPYTEQSTK 

       850        860        870        880        890        900 
MVFFVQNEPP HQIFKGHEVA AMLKSELRKQ KADFLIFRAL EVNTVTCQLN CSDHGHCDSF 

       910        920        930        940        950        960 
TKRCICDPFW MENFIKVQLR DGDSNCEWSV LYVIIATFVI VVALGILSWT VICCCKRQKG 

       970        980        990       1000       1010       1020 
KPKRKSKYKI LDATDQESLE LKPTSRAGIK QKGLLLSSSL MHSESELDSD DAIFTWPDRE 

      1030       1040 
KGKLLHGQNG SVPNGQTPLK ARSPREEIL 

« Hide

Isoform 2 [UniParc].

Checksum: E4D2181467A9353C
Show »

FASTA996109,752
Isoform 3 [UniParc].

Checksum: D920F8CBB52D3CC9
Show »

FASTA49154,656

References

« Hide 'large scale' references
[1]Hao D., Hooi S.
Submitted (OCT-2002) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
[2]"Large-scale cDNA transfection screening for genes related to cancer development and progression."
Wan D., Gong Y., Qin W., Zhang P., Li J., Wei L., Zhou X., Li H., Qiu X., Zhong F., He L., Yu J., Yao G., Jiang H., Qian L., Yu Y., Shu H., Chen X. expand/collapse author list , Xu H., Guo M., Pan Z., Chen Y., Ge C., Yang S., Gu J.
Proc. Natl. Acad. Sci. U.S.A. 101:15724-15729(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
[3]"The DNA sequence and biological annotation of human chromosome 1."
Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K. expand/collapse author list , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[4]Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[5]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Kidney, Lung, Muscle and Placenta.
[6]"The full-ORF clone resource of the German cDNA consortium."
Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I.
BMC Genomics 8:399-399(2007) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 304-1049 (ISOFORM 1).
Tissue: Testis.
[7]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 328-1049 (ISOFORM 1), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
Tissue: Amygdala.
[8]"Prediction of the coding sequences of unidentified human genes. XX. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."
Nagase T., Nakayama M., Nakajima D., Kikuno R., Ohara O.
DNA Res. 8:85-95(2001) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 359-1049 (ISOFORM 2).
Tissue: Brain.
[9]"Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones."
Nakajima D., Okazaki N., Yamakawa H., Kikuno R., Ohara O., Nagase T.
DNA Res. 9:99-106(2002) [PubMed] [Europe PMC] [Abstract]
Cited for: SEQUENCE REVISION.
[10]"Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry."
Chen R., Jiang X., Sun D., Han G., Wang F., Ye M., Wang L., Zou H.
J. Proteome Res. 8:651-661(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-472 AND ASN-525.
Tissue: Liver.
[11]"Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-1037, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Cervix carcinoma.
[12]"Initial characterization of the human central proteome."
Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.
BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
[13]"Dyslexia-associated kiaa0319-like protein interacts with axon guidance receptor nogo receptor 1."
Poon M.W., Tsang W.H., Chan S.O., Li H.M., Ng H.K., Waye M.M.
Cell. Mol. Neurobiol. 31:27-35(2011) [PubMed] [Europe PMC] [Abstract]
Cited for: FUNCTION, INTERACTION WITH RTN4R, GLYCOSYLATION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
[14]"Solution structure of the PKD domain from KIAA1837 protein."
RIKEN structural genomics initiative (RSGI)
Submitted (OCT-2007) to the PDB data bank
Cited for: STRUCTURE BY NMR OF 600-688.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AY163234 mRNA. Translation: AAN61054.1.
AF275679 mRNA. Translation: AAG24389.2.
AF289597 mRNA. Translation: AAL55781.1. Different initiation.
AL356362, AC004865, AL445211 Genomic DNA. Translation: CAI22688.1. Sequence problems.
AL445211, AC004865, AL356362 Genomic DNA. Translation: CAI23123.1. Sequence problems.
AC004865 Genomic DNA. Translation: AAD05028.1. Sequence problems.
CH471059 Genomic DNA. Translation: EAX07415.1.
CH471059 Genomic DNA. Translation: EAX07416.1.
BC001858 mRNA. Translation: AAH01858.2.
BC007645 mRNA. Translation: AAH07645.1.
BC014530 mRNA. Translation: AAH14530.1.
BC031672 mRNA. Translation: AAH31672.2.
AL834315 mRNA. Translation: CAD38985.1.
AK024287 mRNA. Translation: BAB14874.1. Different initiation.
AK090878 mRNA. Translation: BAC03536.1.
AB058740 mRNA. Translation: BAB47466.1. Sequence problems.
RefSeqNP_079150.3. NM_024874.4.
UniGeneHs.456507.
Hs.683078.

3D structure databases

PDBe
RCSB PDB
PDBj
EntryMethodResolution (Å)ChainPositionsPDBsum
2YRLNMR-A600-688[»]
ProteinModelPortalQ8IZA0.
SMRQ8IZA0. Positions 298-400, 417-497, 505-688, 703-785.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

IntActQ8IZA0. 1 interaction.

Polymorphism databases

DMDM187609609.

Proteomic databases

PaxDbQ8IZA0.
PRIDEQ8IZA0.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000325722; ENSP00000318406; ENSG00000142687. [Q8IZA0-1]
GeneID79932.
KEGGhsa:79932.
UCSCuc001byw.3. human. [Q8IZA0-3]
uc001byx.3. human. [Q8IZA0-1]
uc010ohv.1. human. [Q8IZA0-2]

Organism-specific databases

CTD79932.
GeneCardsGC01M035899.
HGNCHGNC:30071. KIAA0319L.
HPAHPA011169.
MIM613535. gene.
neXtProtNX_Q8IZA0.
Orphanet220402. Limited cutaneous systemic sclerosis.
536. Systemic lupus erythematosus.
PharmGKBPA142671625.
HUGESearch...
GenAtlasSearch...

Phylogenomic databases

eggNOGCOG3291.
HOVERGENHBG057130.
OMADSNCEWS.
OrthoDBEOG79PJNJ.
PhylomeDBQ8IZA0.
TreeFamTF323356.

Gene expression databases

ArrayExpressQ8IZA0.
BgeeQ8IZA0.
CleanExHS_KIAA0319L.
GenevestigatorQ8IZA0.

Family and domain databases

Gene3D2.60.40.670. 2 hits.
InterProIPR003961. Fibronectin_type3.
IPR013980. MANSC.
IPR022409. PKD/Chitinase_dom.
IPR002859. PKD/REJ-like.
IPR000601. PKD_dom.
[Graphical view]
PfamPF02010. REJ. 2 hits.
[Graphical view]
SMARTSM00060. FN3. 4 hits.
SM00089. PKD. 5 hits.
[Graphical view]
SUPFAMSSF49299. SSF49299. 4 hits.
PROSITEPS50986. MANSC. 1 hit.
PS50093. PKD. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

ChiTaRSKIAA0319L. human.
EvolutionaryTraceQ8IZA0.
GenomeRNAi79932.
NextBio69860.
SOURCESearch...

Entry information

Entry nameK319L_HUMAN
AccessionPrimary (citable) accession number: Q8IZA0
Secondary accession number(s): B1AN13 expand/collapse secondary AC list , D3DPR8, O95010, Q6PJJ7, Q7L1C9, Q8N2B3, Q8NDA0, Q8WY39, Q8WYZ5, Q96IC3, Q96JJ0, Q9BUW6, Q9H7V0
Entry history
Integrated into UniProtKB/Swiss-Prot: April 29, 2008
Last sequence update: April 29, 2008
Last modified: April 16, 2014
This is version 84 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

PDB cross-references

Index of Protein Data Bank (PDB) cross-references

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 1

Human chromosome 1: entries, gene names and cross-references to MIM