Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q8IZ21

- PHAR4_HUMAN

UniProt

Q8IZ21 - PHAR4_HUMAN

Protein

Phosphatase and actin regulator 4

Gene

PHACTR4

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 96 (01 Oct 2014)
      Sequence version 1 (01 Mar 2003)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Regulator of protein phosphatase 1 (PP1) required for neural tube and optic fissure closure, and enteric neural crest cell (ENCCs) migration during development. Acts as an activator of PP1 by interacting with PPP1CA and preventing phosphorylation of PPP1CA at 'Thr-320'. During neural tube closure, localizes to the ventral neural tube and activates PP1, leading to down-regulate cell proliferation within cranial neural tissue and the neural retina. Also acts as a regulator of migration of enteric neural crest cells (ENCCs) by activating PP1, leading to dephosphorylation and subsequent activation of cofilin (COF1 or COF2) and repression of the integrin signaling through the RHO/ROCK pathway By similarity.By similarity

    GO - Molecular functioni

    1. actin binding Source: UniProtKB
    2. protein phosphatase 1 binding Source: UniProtKB
    3. protein phosphatase type 1 activator activity Source: UniProtKB

    GO - Biological processi

    1. actin cytoskeleton organization Source: UniProtKB
    2. closure of optic fissure Source: UniProtKB
    3. enteric nervous system development Source: UniProtKB
    4. negative regulation of integrin-mediated signaling pathway Source: UniProtKB
    5. neural crest cell migration Source: UniProtKB
    6. neural tube closure Source: UniProtKB
    7. positive regulation of catalytic activity Source: UniProtKB
    8. regulation of cell cycle Source: UniProtKB
    9. Rho protein signal transduction Source: UniProtKB

    Keywords - Molecular functioni

    Developmental protein

    Keywords - Biological processi

    Neurogenesis

    Keywords - Ligandi

    Actin-binding

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Phosphatase and actin regulator 4
    Gene namesi
    Name:PHACTR4
    ORF Names:PRO2963
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 1

    Organism-specific databases

    HGNCiHGNC:25793. PHACTR4.

    Subcellular locationi

    Cytoplasm By similarity. Cell projectionlamellipodium By similarity

    GO - Cellular componenti

    1. cytoplasm Source: UniProtKB-SubCell
    2. lamellipodium Source: UniProtKB

    Keywords - Cellular componenti

    Cell projection, Cytoplasm

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA134959472.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 702702Phosphatase and actin regulator 4PRO_0000287306Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei118 – 1181Phosphoserine1 Publication
    Modified residuei131 – 1311Phosphoserine1 Publication
    Modified residuei342 – 3421Phosphoserine1 Publication
    Modified residuei344 – 3441Phosphoserine1 Publication
    Modified residuei358 – 3581Phosphothreonine1 Publication
    Modified residuei427 – 4271Phosphoserine1 Publication
    Modified residuei432 – 4321Phosphothreonine1 Publication
    Modified residuei443 – 4431PhosphoserineBy similarity
    Modified residuei464 – 4641Phosphoserine1 Publication
    Modified residuei628 – 6281Phosphoserine4 Publications

    Keywords - PTMi

    Phosphoprotein

    Proteomic databases

    MaxQBiQ8IZ21.
    PaxDbiQ8IZ21.
    PRIDEiQ8IZ21.

    PTM databases

    PhosphoSiteiQ8IZ21.

    Miscellaneous databases

    PMAP-CutDBQ8IZ21.

    Expressioni

    Gene expression databases

    BgeeiQ8IZ21.
    CleanExiHS_PHACTR4.
    GenevestigatoriQ8IZ21.

    Organism-specific databases

    HPAiHPA028985.

    Interactioni

    Subunit structurei

    Binds PPP1CA and actin.By similarity

    Protein-protein interaction databases

    BioGridi122429. 10 interactions.
    DIPiDIP-47323N.
    IntActiQ8IZ21. 3 interactions.

    Structurei

    3D structure databases

    ProteinModelPortaliQ8IZ21.
    SMRiQ8IZ21. Positions 544-650.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Repeati63 – 8826RPEL 1Add
    BLAST
    Repeati583 – 60826RPEL 2Add
    BLAST
    Repeati621 – 64626RPEL 3Add
    BLAST

    Compositional bias

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Compositional biasi227 – 433207Pro-richAdd
    BLAST
    Compositional biasi478 – 4825Poly-Glu
    Compositional biasi508 – 5136Poly-Glu

    Sequence similaritiesi

    Contains 3 RPEL repeats.PROSITE-ProRule annotation

    Keywords - Domaini

    Repeat

    Phylogenomic databases

    eggNOGiNOG275065.
    HOVERGENiHBG108247.
    KOiK17585.
    OMAiREKSTCS.
    OrthoDBiEOG7QG44R.
    PhylomeDBiQ8IZ21.
    TreeFamiTF316316.

    Family and domain databases

    InterProiIPR004018. RPEL_repeat.
    [Graphical view]
    PfamiPF02755. RPEL. 3 hits.
    [Graphical view]
    SMARTiSM00707. RPEL. 3 hits.
    [Graphical view]
    PROSITEiPS51073. RPEL. 3 hits.
    [Graphical view]

    Sequences (4)i

    Sequence statusi: Complete.

    This entry describes 4 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q8IZ21-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MEDPFEEADQ PTTEPGMVLD SVEAGDTTPP TKRKSKFSGF GKIFKPWKWR    50
    KKKSSDKFKE TSEVLERKIS MRKPREELVK RGVLLEDPEQ GGEDPGKPSD 100
    AMLKNGHTTP IGNARSSSPV QVEEEPVRLA SLRKAIPEED LKKRLGSTGS 150
    QPNSEAESVP ENVPKPPLLP PKRPLSSSHE ASEGQAKDAT SSGGTARFII 200
    STSITTAPAA TTAATSLAKT VNLSVTPSPA PRTLPAAPAS TNTTATPSLT 250
    HMVPAKQPPI PPPKPAHRNS NPVIAELSQA INSGTLLSKP SPPLPPKRGI 300
    PSTSVPTLES AAAITTKTPS DEREKSTCSM GSELLPMISP RSPSPPLPTH 350
    IPPEPPRTPP FPAKTFQVVP EIEFPPSLDL HQEIPQQEDQ KKEVPKRILD 400
    QNFGEPHIPS RLPPLPLHIR IQQALTSPLP MTPILEGSHR AHSLLFENSD 450
    SFSEDSSTLG RTRSLPITIE MLKVPDDEEE EEQTCPSTFS EEMTPTSVIP 500
    KLPQCLREEE EKESDSDSEG PIQYRDEEDE DESYQSALAN KVKRKDTLAM 550
    KLNHRPSEPE LNLNSWPCKS KEEWNEIRHQ IGNTLIRRLS QRPTPEELEQ 600
    RNILQPKNEA DRQAEKREIK RRLTRKLSQR PTVAELLARK ILRFNEYVEV 650
    TDAQDYDRRA DKPWTKLTPA DKAAIRKELN EFKSSEMEVH EESKHFTRYH 700
    RP 702
    Length:702
    Mass (Da):78,211
    Last modified:March 1, 2003 - v1
    Checksum:i89AC6A1D08411948
    GO
    Isoform 2 (identifier: Q8IZ21-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-5: MEDPF → MGQADVSRPVNPDAV

    Show »
    Length:712
    Mass (Da):79,129
    Checksum:i3F9C6DE318A7B2F0
    GO
    Isoform 3 (identifier: Q8IZ21-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-16: Missing.

    Show »
    Length:686
    Mass (Da):76,436
    Checksum:iD08F12D5D26DB362
    GO
    Isoform 4 (identifier: Q8IZ21-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         6-6: E → DFSREPWNSRGSRPAHYRARHGPGQCGSRRHNTSYQKEEQVLRLWQDLQALEMEEKKK
         7-702: Missing.

    Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.

    Show »
    Length:63
    Mass (Da):7,586
    Checksum:iC71BB87679575723
    GO

    Sequence cautioni

    The sequence BAB15130.1 differs from that shown. Reason: Frameshift at position 51.
    The sequence CAH18286.1 differs from that shown. Reason: Frameshift at position 53.
    The sequence AAG35507.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.
    The sequence BAB14483.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti183 – 1831E → G in CAH18286. (PubMed:17974005)Curated
    Sequence conflicti459 – 4591L → P in BAB14483. (PubMed:14702039)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 1616Missing in isoform 3. 1 PublicationVSP_025436Add
    BLAST
    Alternative sequencei1 – 55MEDPF → MGQADVSRPVNPDAV in isoform 2. 1 PublicationVSP_025437
    Alternative sequencei6 – 61E → DFSREPWNSRGSRPAHYRAR HGPGQCGSRRHNTSYQKEEQ VLRLWQDLQALEMEEKKK in isoform 4. 1 PublicationVSP_039730
    Alternative sequencei7 – 702696Missing in isoform 4. 1 PublicationVSP_039731Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK023233 mRNA. Translation: BAB14483.1. Different initiation.
    AK025436 mRNA. Translation: BAB15130.1. Frameshift.
    CR749449 mRNA. Translation: CAH18286.1. Frameshift.
    AL670471, CR391992, AL360012 Genomic DNA. Translation: CAM12870.1.
    CR589951, AL360012, CR391992 Genomic DNA. Translation: CAM12871.1.
    CH471059 Genomic DNA. Translation: EAX07696.1.
    CH471059 Genomic DNA. Translation: EAX07698.1.
    BC021247 mRNA. Translation: AAH21247.3.
    BC029266 mRNA. Translation: AAH29266.1.
    BC068508 mRNA. Translation: AAH68508.1. Sequence problems.
    AF130081 mRNA. Translation: AAG35507.1. Different initiation.
    CCDSiCCDS41293.1. [Q8IZ21-1]
    CCDS41294.1. [Q8IZ21-2]
    RefSeqiNP_001041648.1. NM_001048183.1. [Q8IZ21-1]
    NP_076412.3. NM_023923.3. [Q8IZ21-2]
    UniGeneiHs.225641.

    Genome annotation databases

    EnsembliENST00000373836; ENSP00000362942; ENSG00000204138. [Q8IZ21-2]
    ENST00000373839; ENSP00000362945; ENSG00000204138. [Q8IZ21-1]
    GeneIDi65979.
    KEGGihsa:65979.
    UCSCiuc001bpw.3. human. [Q8IZ21-1]
    uc001bpy.3. human. [Q8IZ21-2]

    Polymorphism databases

    DMDMi74728415.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK023233 mRNA. Translation: BAB14483.1 . Different initiation.
    AK025436 mRNA. Translation: BAB15130.1 . Frameshift.
    CR749449 mRNA. Translation: CAH18286.1 . Frameshift.
    AL670471 , CR391992 , AL360012 Genomic DNA. Translation: CAM12870.1 .
    CR589951 , AL360012 , CR391992 Genomic DNA. Translation: CAM12871.1 .
    CH471059 Genomic DNA. Translation: EAX07696.1 .
    CH471059 Genomic DNA. Translation: EAX07698.1 .
    BC021247 mRNA. Translation: AAH21247.3 .
    BC029266 mRNA. Translation: AAH29266.1 .
    BC068508 mRNA. Translation: AAH68508.1 . Sequence problems.
    AF130081 mRNA. Translation: AAG35507.1 . Different initiation.
    CCDSi CCDS41293.1. [Q8IZ21-1 ]
    CCDS41294.1. [Q8IZ21-2 ]
    RefSeqi NP_001041648.1. NM_001048183.1. [Q8IZ21-1 ]
    NP_076412.3. NM_023923.3. [Q8IZ21-2 ]
    UniGenei Hs.225641.

    3D structure databases

    ProteinModelPortali Q8IZ21.
    SMRi Q8IZ21. Positions 544-650.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 122429. 10 interactions.
    DIPi DIP-47323N.
    IntActi Q8IZ21. 3 interactions.

    PTM databases

    PhosphoSitei Q8IZ21.

    Polymorphism databases

    DMDMi 74728415.

    Proteomic databases

    MaxQBi Q8IZ21.
    PaxDbi Q8IZ21.
    PRIDEi Q8IZ21.

    Protocols and materials databases

    DNASUi 65979.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000373836 ; ENSP00000362942 ; ENSG00000204138 . [Q8IZ21-2 ]
    ENST00000373839 ; ENSP00000362945 ; ENSG00000204138 . [Q8IZ21-1 ]
    GeneIDi 65979.
    KEGGi hsa:65979.
    UCSCi uc001bpw.3. human. [Q8IZ21-1 ]
    uc001bpy.3. human. [Q8IZ21-2 ]

    Organism-specific databases

    CTDi 65979.
    GeneCardsi GC01P028696.
    HGNCi HGNC:25793. PHACTR4.
    HPAi HPA028985.
    MIMi 608726. gene.
    neXtProti NX_Q8IZ21.
    PharmGKBi PA134959472.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG275065.
    HOVERGENi HBG108247.
    KOi K17585.
    OMAi REKSTCS.
    OrthoDBi EOG7QG44R.
    PhylomeDBi Q8IZ21.
    TreeFami TF316316.

    Miscellaneous databases

    ChiTaRSi PHACTR4. human.
    GenomeRNAii 65979.
    NextBioi 67423.
    PMAP-CutDB Q8IZ21.
    PROi Q8IZ21.
    SOURCEi Search...

    Gene expression databases

    Bgeei Q8IZ21.
    CleanExi HS_PHACTR4.
    Genevestigatori Q8IZ21.

    Family and domain databases

    InterProi IPR004018. RPEL_repeat.
    [Graphical view ]
    Pfami PF02755. RPEL. 3 hits.
    [Graphical view ]
    SMARTi SM00707. RPEL. 3 hits.
    [Graphical view ]
    PROSITEi PS51073. RPEL. 3 hits.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 271-702 (ISOFORM 1).
    2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Fetal brain.
    3. "The DNA sequence and biological annotation of human chromosome 1."
      Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K.
      , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
      Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2 AND 4).
      Tissue: Adrenal cortex, Skin and Testis.
    6. "Functional prediction of the coding sequences of 75 new genes deduced by analysis of cDNA clones from human fetal liver."
      Zhang C., Yu Y., Zhang S., Wei H., Bi J., Zhou G., Dong C., Zai Y., Xu W., Gao F., Liu M., He F.
      Submitted (FEB-1999) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 365-702 (ISOFORM 1).
      Tissue: Fetal liver.
    7. "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks."
      Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M.
      Cell 127:635-648(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-628, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    8. "A probability-based approach for high-throughput protein phosphorylation analysis and site localization."
      Beausoleil S.A., Villen J., Gerber S.A., Rush J., Gygi S.P.
      Nat. Biotechnol. 24:1285-1292(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    9. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-131; SER-342; SER-344; THR-358; SER-427; THR-432 AND SER-628, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    10. "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach."
      Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S.
      Anal. Chem. 81:4493-4501(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    11. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
      Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
      Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Leukemic T-cell.
    12. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
      Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
      Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-628, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    13. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    14. "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
      Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
      Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-118; SER-464 AND SER-628, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

    Entry informationi

    Entry nameiPHAR4_HUMAN
    AccessioniPrimary (citable) accession number: Q8IZ21
    Secondary accession number(s): A2APK6
    , B9ZVW0, D3DPM3, Q68DD4, Q6NUN6, Q8N384, Q9H395, Q9H6X0, Q9H8W6
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: May 15, 2007
    Last sequence update: March 1, 2003
    Last modified: October 1, 2014
    This is version 96 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 1
      Human chromosome 1: entries, gene names and cross-references to MIM
    2. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    3. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3