Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Phosphatase and actin regulator 4

Gene

PHACTR4

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Regulator of protein phosphatase 1 (PP1) required for neural tube and optic fissure closure, and enteric neural crest cell (ENCCs) migration during development. Acts as an activator of PP1 by interacting with PPP1CA and preventing phosphorylation of PPP1CA at 'Thr-320'. During neural tube closure, localizes to the ventral neural tube and activates PP1, leading to down-regulate cell proliferation within cranial neural tissue and the neural retina. Also acts as a regulator of migration of enteric neural crest cells (ENCCs) by activating PP1, leading to dephosphorylation and subsequent activation of cofilin (COF1 or COF2) and repression of the integrin signaling through the RHO/ROCK pathway (By similarity).By similarity

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionActin-binding, Developmental protein
Biological processNeurogenesis

Names & Taxonomyi

Protein namesi
Recommended name:
Phosphatase and actin regulator 4
Gene namesi
Name:PHACTR4
ORF Names:PRO2963
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

EuPathDBiHostDB:ENSG00000204138.12
HGNCiHGNC:25793 PHACTR4
MIMi608726 gene
neXtProtiNX_Q8IZ21

Subcellular locationi

Keywords - Cellular componenti

Cell projection, Cytoplasm

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000204138
PharmGKBiPA134959472

Polymorphism and mutation databases

BioMutaiPHACTR4
DMDMi74728415

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002873061 – 702Phosphatase and actin regulator 4Add BLAST702

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei116PhosphoserineBy similarity1
Modified residuei118PhosphoserineCombined sources1
Modified residuei131PhosphoserineCombined sources1
Modified residuei147PhosphoserineCombined sources1
Modified residuei270PhosphoserineBy similarity1
Modified residuei291PhosphoserineCombined sources1
Modified residuei342PhosphoserineCombined sources1
Modified residuei344PhosphoserineCombined sources1
Modified residuei358PhosphothreonineCombined sources1
Modified residuei427PhosphoserineCombined sources1
Modified residuei432PhosphothreonineCombined sources1
Modified residuei443PhosphoserineCombined sources1
Modified residuei453PhosphoserineBy similarity1
Modified residuei464PhosphoserineCombined sources1
Modified residuei514PhosphoserineBy similarity1
Modified residuei516PhosphoserineBy similarity1
Modified residuei557PhosphoserineCombined sources1
Modified residuei590PhosphoserineCombined sources1
Modified residuei628PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ8IZ21
MaxQBiQ8IZ21
PaxDbiQ8IZ21
PeptideAtlasiQ8IZ21
PRIDEiQ8IZ21

PTM databases

iPTMnetiQ8IZ21
PhosphoSitePlusiQ8IZ21

Miscellaneous databases

PMAP-CutDBQ8IZ21

Expressioni

Gene expression databases

BgeeiENSG00000204138
CleanExiHS_PHACTR4
ExpressionAtlasiQ8IZ21 baseline and differential
GenevisibleiQ8IZ21 HS

Organism-specific databases

HPAiHPA028985

Interactioni

Subunit structurei

Binds PPP1CA and actin.By similarity

GO - Molecular functioni

Protein-protein interaction databases

BioGridi122429, 27 interactors
DIPiDIP-47323N
IntActiQ8IZ21, 15 interactors

Structurei

3D structure databases

ProteinModelPortaliQ8IZ21
SMRiQ8IZ21
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Repeati63 – 88RPEL 1Add BLAST26
Repeati583 – 608RPEL 2Add BLAST26
Repeati621 – 646RPEL 3Add BLAST26

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi227 – 433Pro-richAdd BLAST207
Compositional biasi478 – 482Poly-Glu5
Compositional biasi508 – 513Poly-Glu6

Sequence similaritiesi

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiENOG410IMQR Eukaryota
ENOG4111W4B LUCA
GeneTreeiENSGT00390000004420
HOVERGENiHBG108247
InParanoidiQ8IZ21
KOiK17585
OMAiREKSTCS
OrthoDBiEOG091G0HBF
PhylomeDBiQ8IZ21
TreeFamiTF316316

Family and domain databases

InterProiView protein in InterPro
IPR029984 Phactr4
IPR004018 RPEL_repeat
PANTHERiPTHR12751:SF4 PTHR12751:SF4, 1 hit
PfamiView protein in Pfam
PF02755 RPEL, 3 hits
SMARTiView protein in SMART
SM00707 RPEL, 3 hits
PROSITEiView protein in PROSITE
PS51073 RPEL, 3 hits

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8IZ21-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MEDPFEEADQ PTTEPGMVLD SVEAGDTTPP TKRKSKFSGF GKIFKPWKWR
60 70 80 90 100
KKKSSDKFKE TSEVLERKIS MRKPREELVK RGVLLEDPEQ GGEDPGKPSD
110 120 130 140 150
AMLKNGHTTP IGNARSSSPV QVEEEPVRLA SLRKAIPEED LKKRLGSTGS
160 170 180 190 200
QPNSEAESVP ENVPKPPLLP PKRPLSSSHE ASEGQAKDAT SSGGTARFII
210 220 230 240 250
STSITTAPAA TTAATSLAKT VNLSVTPSPA PRTLPAAPAS TNTTATPSLT
260 270 280 290 300
HMVPAKQPPI PPPKPAHRNS NPVIAELSQA INSGTLLSKP SPPLPPKRGI
310 320 330 340 350
PSTSVPTLES AAAITTKTPS DEREKSTCSM GSELLPMISP RSPSPPLPTH
360 370 380 390 400
IPPEPPRTPP FPAKTFQVVP EIEFPPSLDL HQEIPQQEDQ KKEVPKRILD
410 420 430 440 450
QNFGEPHIPS RLPPLPLHIR IQQALTSPLP MTPILEGSHR AHSLLFENSD
460 470 480 490 500
SFSEDSSTLG RTRSLPITIE MLKVPDDEEE EEQTCPSTFS EEMTPTSVIP
510 520 530 540 550
KLPQCLREEE EKESDSDSEG PIQYRDEEDE DESYQSALAN KVKRKDTLAM
560 570 580 590 600
KLNHRPSEPE LNLNSWPCKS KEEWNEIRHQ IGNTLIRRLS QRPTPEELEQ
610 620 630 640 650
RNILQPKNEA DRQAEKREIK RRLTRKLSQR PTVAELLARK ILRFNEYVEV
660 670 680 690 700
TDAQDYDRRA DKPWTKLTPA DKAAIRKELN EFKSSEMEVH EESKHFTRYH

RP
Length:702
Mass (Da):78,211
Last modified:March 1, 2003 - v1
Checksum:i89AC6A1D08411948
GO
Isoform 2 (identifier: Q8IZ21-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-5: MEDPF → MGQADVSRPVNPDAV

Show »
Length:712
Mass (Da):79,129
Checksum:i3F9C6DE318A7B2F0
GO
Isoform 3 (identifier: Q8IZ21-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-16: Missing.

Show »
Length:686
Mass (Da):76,436
Checksum:iD08F12D5D26DB362
GO
Isoform 4 (identifier: Q8IZ21-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     6-6: E → DFSREPWNSRGSRPAHYRARHGPGQCGSRRHNTSYQKEEQVLRLWQDLQALEMEEKKK
     7-702: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Show »
Length:63
Mass (Da):7,586
Checksum:iC71BB87679575723
GO

Sequence cautioni

The sequence AAG35507 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence AAH68508 differs from that shown. Reason: Erroneous translation. Wrong choice of CDS.Curated
The sequence BAB14483 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence BAB15130 differs from that shown. Reason: Frameshift at position 51.Curated
The sequence CAH18286 differs from that shown. Reason: Frameshift at position 53.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti183E → G in CAH18286 (PubMed:17974005).Curated1
Sequence conflicti459L → P in BAB14483 (PubMed:14702039).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0254361 – 16Missing in isoform 3. 1 PublicationAdd BLAST16
Alternative sequenceiVSP_0254371 – 5MEDPF → MGQADVSRPVNPDAV in isoform 2. 1 Publication5
Alternative sequenceiVSP_0397306E → DFSREPWNSRGSRPAHYRAR HGPGQCGSRRHNTSYQKEEQ VLRLWQDLQALEMEEKKK in isoform 4. 1 Publication1
Alternative sequenceiVSP_0397317 – 702Missing in isoform 4. 1 PublicationAdd BLAST696

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK023233 mRNA Translation: BAB14483.1 Different initiation.
AK025436 mRNA Translation: BAB15130.1 Frameshift.
CR749449 mRNA Translation: CAH18286.1 Frameshift.
AL360012 Genomic DNA No translation available.
AL670471 Genomic DNA No translation available.
CR391992 Genomic DNA No translation available.
CR589951 Genomic DNA No translation available.
CH471059 Genomic DNA Translation: EAX07696.1
CH471059 Genomic DNA Translation: EAX07698.1
BC021247 mRNA Translation: AAH21247.3
BC029266 mRNA Translation: AAH29266.1
BC068508 mRNA Translation: AAH68508.1 Sequence problems.
AF130081 mRNA Translation: AAG35507.1 Different initiation.
CCDSiCCDS41293.1 [Q8IZ21-1]
CCDS41294.1 [Q8IZ21-2]
RefSeqiNP_001041648.1, NM_001048183.1 [Q8IZ21-1]
NP_076412.3, NM_023923.3 [Q8IZ21-2]
XP_016857657.1, XM_017002168.1
XP_016857662.1, XM_017002173.1
UniGeneiHs.225641

Genome annotation databases

EnsembliENST00000373836; ENSP00000362942; ENSG00000204138 [Q8IZ21-2]
ENST00000373839; ENSP00000362945; ENSG00000204138 [Q8IZ21-1]
ENST00000493669; ENSP00000488359; ENSG00000204138 [Q8IZ21-4]
GeneIDi65979
KEGGihsa:65979
UCSCiuc001bpw.4 human [Q8IZ21-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiPHAR4_HUMAN
AccessioniPrimary (citable) accession number: Q8IZ21
Secondary accession number(s): A2APK6
, B9ZVW0, D3DPM3, Q68DD4, Q6NUN6, Q8N384, Q9H395, Q9H6X0, Q9H8W6
Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 15, 2007
Last sequence update: March 1, 2003
Last modified: May 23, 2018
This is version 124 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Cookie policy

We would like to use anonymized google analytics cookies to gather statistics on how uniprot.org is used in aggregate. Learn more

UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health