Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q8IZ21

- PHAR4_HUMAN

UniProt

Q8IZ21 - PHAR4_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Phosphatase and actin regulator 4

Gene

PHACTR4

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Regulator of protein phosphatase 1 (PP1) required for neural tube and optic fissure closure, and enteric neural crest cell (ENCCs) migration during development. Acts as an activator of PP1 by interacting with PPP1CA and preventing phosphorylation of PPP1CA at 'Thr-320'. During neural tube closure, localizes to the ventral neural tube and activates PP1, leading to down-regulate cell proliferation within cranial neural tissue and the neural retina. Also acts as a regulator of migration of enteric neural crest cells (ENCCs) by activating PP1, leading to dephosphorylation and subsequent activation of cofilin (COF1 or COF2) and repression of the integrin signaling through the RHO/ROCK pathway (By similarity).By similarity

GO - Molecular functioni

  1. actin binding Source: UniProtKB
  2. protein phosphatase 1 binding Source: UniProtKB
  3. protein phosphatase type 1 activator activity Source: UniProtKB

GO - Biological processi

  1. actin cytoskeleton organization Source: UniProtKB
  2. closure of optic fissure Source: UniProtKB
  3. enteric nervous system development Source: UniProtKB
  4. negative regulation of integrin-mediated signaling pathway Source: UniProtKB
  5. neural crest cell migration Source: UniProtKB
  6. neural tube closure Source: UniProtKB
  7. positive regulation of catalytic activity Source: UniProtKB
  8. regulation of cell cycle Source: UniProtKB
  9. Rho protein signal transduction Source: UniProtKB
Complete GO annotation...

Keywords - Molecular functioni

Developmental protein

Keywords - Biological processi

Neurogenesis

Keywords - Ligandi

Actin-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Phosphatase and actin regulator 4
Gene namesi
Name:PHACTR4
ORF Names:PRO2963
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 1

Organism-specific databases

HGNCiHGNC:25793. PHACTR4.

Subcellular locationi

Cytoplasm By similarity. Cell projectionlamellipodium By similarity

GO - Cellular componenti

  1. cytoplasm Source: UniProtKB-KW
  2. lamellipodium Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cell projection, Cytoplasm

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134959472.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 702702Phosphatase and actin regulator 4PRO_0000287306Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei118 – 1181Phosphoserine1 Publication
Modified residuei131 – 1311Phosphoserine1 Publication
Modified residuei342 – 3421Phosphoserine1 Publication
Modified residuei344 – 3441Phosphoserine1 Publication
Modified residuei358 – 3581Phosphothreonine1 Publication
Modified residuei427 – 4271Phosphoserine1 Publication
Modified residuei432 – 4321Phosphothreonine1 Publication
Modified residuei443 – 4431PhosphoserineBy similarity
Modified residuei464 – 4641Phosphoserine1 Publication
Modified residuei628 – 6281Phosphoserine4 Publications

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ8IZ21.
PaxDbiQ8IZ21.
PRIDEiQ8IZ21.

PTM databases

PhosphoSiteiQ8IZ21.

Miscellaneous databases

PMAP-CutDBQ8IZ21.

Expressioni

Gene expression databases

BgeeiQ8IZ21.
CleanExiHS_PHACTR4.
GenevestigatoriQ8IZ21.

Organism-specific databases

HPAiHPA028985.

Interactioni

Subunit structurei

Binds PPP1CA and actin.By similarity

Protein-protein interaction databases

BioGridi122429. 12 interactions.
DIPiDIP-47323N.
IntActiQ8IZ21. 3 interactions.

Structurei

3D structure databases

ProteinModelPortaliQ8IZ21.
SMRiQ8IZ21. Positions 544-650.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Repeati63 – 8826RPEL 1Add
BLAST
Repeati583 – 60826RPEL 2Add
BLAST
Repeati621 – 64626RPEL 3Add
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi227 – 433207Pro-richAdd
BLAST
Compositional biasi478 – 4825Poly-Glu
Compositional biasi508 – 5136Poly-Glu

Sequence similaritiesi

Contains 3 RPEL repeats.PROSITE-ProRule annotation

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiNOG275065.
GeneTreeiENSGT00390000004420.
HOVERGENiHBG108247.
InParanoidiQ8IZ21.
KOiK17585.
OMAiREKSTCS.
OrthoDBiEOG7QG44R.
PhylomeDBiQ8IZ21.
TreeFamiTF316316.

Family and domain databases

InterProiIPR004018. RPEL_repeat.
[Graphical view]
PfamiPF02755. RPEL. 3 hits.
[Graphical view]
SMARTiSM00707. RPEL. 3 hits.
[Graphical view]
PROSITEiPS51073. RPEL. 3 hits.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q8IZ21-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MEDPFEEADQ PTTEPGMVLD SVEAGDTTPP TKRKSKFSGF GKIFKPWKWR
60 70 80 90 100
KKKSSDKFKE TSEVLERKIS MRKPREELVK RGVLLEDPEQ GGEDPGKPSD
110 120 130 140 150
AMLKNGHTTP IGNARSSSPV QVEEEPVRLA SLRKAIPEED LKKRLGSTGS
160 170 180 190 200
QPNSEAESVP ENVPKPPLLP PKRPLSSSHE ASEGQAKDAT SSGGTARFII
210 220 230 240 250
STSITTAPAA TTAATSLAKT VNLSVTPSPA PRTLPAAPAS TNTTATPSLT
260 270 280 290 300
HMVPAKQPPI PPPKPAHRNS NPVIAELSQA INSGTLLSKP SPPLPPKRGI
310 320 330 340 350
PSTSVPTLES AAAITTKTPS DEREKSTCSM GSELLPMISP RSPSPPLPTH
360 370 380 390 400
IPPEPPRTPP FPAKTFQVVP EIEFPPSLDL HQEIPQQEDQ KKEVPKRILD
410 420 430 440 450
QNFGEPHIPS RLPPLPLHIR IQQALTSPLP MTPILEGSHR AHSLLFENSD
460 470 480 490 500
SFSEDSSTLG RTRSLPITIE MLKVPDDEEE EEQTCPSTFS EEMTPTSVIP
510 520 530 540 550
KLPQCLREEE EKESDSDSEG PIQYRDEEDE DESYQSALAN KVKRKDTLAM
560 570 580 590 600
KLNHRPSEPE LNLNSWPCKS KEEWNEIRHQ IGNTLIRRLS QRPTPEELEQ
610 620 630 640 650
RNILQPKNEA DRQAEKREIK RRLTRKLSQR PTVAELLARK ILRFNEYVEV
660 670 680 690 700
TDAQDYDRRA DKPWTKLTPA DKAAIRKELN EFKSSEMEVH EESKHFTRYH

RP
Length:702
Mass (Da):78,211
Last modified:March 1, 2003 - v1
Checksum:i89AC6A1D08411948
GO
Isoform 2 (identifier: Q8IZ21-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-5: MEDPF → MGQADVSRPVNPDAV

Show »
Length:712
Mass (Da):79,129
Checksum:i3F9C6DE318A7B2F0
GO
Isoform 3 (identifier: Q8IZ21-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-16: Missing.

Show »
Length:686
Mass (Da):76,436
Checksum:iD08F12D5D26DB362
GO
Isoform 4 (identifier: Q8IZ21-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     6-6: E → DFSREPWNSRGSRPAHYRARHGPGQCGSRRHNTSYQKEEQVLRLWQDLQALEMEEKKK
     7-702: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.

Show »
Length:63
Mass (Da):7,586
Checksum:iC71BB87679575723
GO

Sequence cautioni

The sequence BAB15130.1 differs from that shown. Reason: Frameshift at position 51.
The sequence CAH18286.1 differs from that shown. Reason: Frameshift at position 53.
The sequence AAG35507.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.
The sequence BAB14483.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti183 – 1831E → G in CAH18286. (PubMed:17974005)Curated
Sequence conflicti459 – 4591L → P in BAB14483. (PubMed:14702039)Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 1616Missing in isoform 3. 1 PublicationVSP_025436Add
BLAST
Alternative sequencei1 – 55MEDPF → MGQADVSRPVNPDAV in isoform 2. 1 PublicationVSP_025437
Alternative sequencei6 – 61E → DFSREPWNSRGSRPAHYRAR HGPGQCGSRRHNTSYQKEEQ VLRLWQDLQALEMEEKKK in isoform 4. 1 PublicationVSP_039730
Alternative sequencei7 – 702696Missing in isoform 4. 1 PublicationVSP_039731Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AK023233 mRNA. Translation: BAB14483.1. Different initiation.
AK025436 mRNA. Translation: BAB15130.1. Frameshift.
CR749449 mRNA. Translation: CAH18286.1. Frameshift.
AL670471, CR391992, AL360012 Genomic DNA. Translation: CAM12870.1.
CR589951, AL360012, CR391992 Genomic DNA. Translation: CAM12871.1.
CH471059 Genomic DNA. Translation: EAX07696.1.
CH471059 Genomic DNA. Translation: EAX07698.1.
BC021247 mRNA. Translation: AAH21247.3.
BC029266 mRNA. Translation: AAH29266.1.
BC068508 mRNA. Translation: AAH68508.1. Sequence problems.
AF130081 mRNA. Translation: AAG35507.1. Different initiation.
CCDSiCCDS41293.1. [Q8IZ21-1]
CCDS41294.1. [Q8IZ21-2]
RefSeqiNP_001041648.1. NM_001048183.1. [Q8IZ21-1]
NP_076412.3. NM_023923.3. [Q8IZ21-2]
UniGeneiHs.225641.

Genome annotation databases

EnsembliENST00000373836; ENSP00000362942; ENSG00000204138. [Q8IZ21-2]
ENST00000373839; ENSP00000362945; ENSG00000204138. [Q8IZ21-1]
GeneIDi65979.
KEGGihsa:65979.
UCSCiuc001bpw.3. human. [Q8IZ21-1]
uc001bpy.3. human. [Q8IZ21-2]

Polymorphism databases

DMDMi74728415.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AK023233 mRNA. Translation: BAB14483.1 . Different initiation.
AK025436 mRNA. Translation: BAB15130.1 . Frameshift.
CR749449 mRNA. Translation: CAH18286.1 . Frameshift.
AL670471 , CR391992 , AL360012 Genomic DNA. Translation: CAM12870.1 .
CR589951 , AL360012 , CR391992 Genomic DNA. Translation: CAM12871.1 .
CH471059 Genomic DNA. Translation: EAX07696.1 .
CH471059 Genomic DNA. Translation: EAX07698.1 .
BC021247 mRNA. Translation: AAH21247.3 .
BC029266 mRNA. Translation: AAH29266.1 .
BC068508 mRNA. Translation: AAH68508.1 . Sequence problems.
AF130081 mRNA. Translation: AAG35507.1 . Different initiation.
CCDSi CCDS41293.1. [Q8IZ21-1 ]
CCDS41294.1. [Q8IZ21-2 ]
RefSeqi NP_001041648.1. NM_001048183.1. [Q8IZ21-1 ]
NP_076412.3. NM_023923.3. [Q8IZ21-2 ]
UniGenei Hs.225641.

3D structure databases

ProteinModelPortali Q8IZ21.
SMRi Q8IZ21. Positions 544-650.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 122429. 12 interactions.
DIPi DIP-47323N.
IntActi Q8IZ21. 3 interactions.

PTM databases

PhosphoSitei Q8IZ21.

Polymorphism databases

DMDMi 74728415.

Proteomic databases

MaxQBi Q8IZ21.
PaxDbi Q8IZ21.
PRIDEi Q8IZ21.

Protocols and materials databases

DNASUi 65979.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000373836 ; ENSP00000362942 ; ENSG00000204138 . [Q8IZ21-2 ]
ENST00000373839 ; ENSP00000362945 ; ENSG00000204138 . [Q8IZ21-1 ]
GeneIDi 65979.
KEGGi hsa:65979.
UCSCi uc001bpw.3. human. [Q8IZ21-1 ]
uc001bpy.3. human. [Q8IZ21-2 ]

Organism-specific databases

CTDi 65979.
GeneCardsi GC01P028696.
HGNCi HGNC:25793. PHACTR4.
HPAi HPA028985.
MIMi 608726. gene.
neXtProti NX_Q8IZ21.
PharmGKBi PA134959472.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG275065.
GeneTreei ENSGT00390000004420.
HOVERGENi HBG108247.
InParanoidi Q8IZ21.
KOi K17585.
OMAi REKSTCS.
OrthoDBi EOG7QG44R.
PhylomeDBi Q8IZ21.
TreeFami TF316316.

Miscellaneous databases

ChiTaRSi PHACTR4. human.
GenomeRNAii 65979.
NextBioi 67423.
PMAP-CutDB Q8IZ21.
PROi Q8IZ21.
SOURCEi Search...

Gene expression databases

Bgeei Q8IZ21.
CleanExi HS_PHACTR4.
Genevestigatori Q8IZ21.

Family and domain databases

InterProi IPR004018. RPEL_repeat.
[Graphical view ]
Pfami PF02755. RPEL. 3 hits.
[Graphical view ]
SMARTi SM00707. RPEL. 3 hits.
[Graphical view ]
PROSITEi PS51073. RPEL. 3 hits.
[Graphical view ]
ProtoNeti Search...

Publicationsi

  1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 271-702 (ISOFORM 1).
  2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Fetal brain.
  3. "The DNA sequence and biological annotation of human chromosome 1."
    Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K.
    , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
    Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2 AND 4).
    Tissue: Adrenal cortex, Skin and Testis.
  6. "Functional prediction of the coding sequences of 75 new genes deduced by analysis of cDNA clones from human fetal liver."
    Zhang C., Yu Y., Zhang S., Wei H., Bi J., Zhou G., Dong C., Zai Y., Xu W., Gao F., Liu M., He F.
    Submitted (FEB-1999) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 365-702 (ISOFORM 1).
    Tissue: Fetal liver.
  7. "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks."
    Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M.
    Cell 127:635-648(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-628, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  8. "A probability-based approach for high-throughput protein phosphorylation analysis and site localization."
    Beausoleil S.A., Villen J., Gerber S.A., Rush J., Gygi S.P.
    Nat. Biotechnol. 24:1285-1292(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  9. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-131; SER-342; SER-344; THR-358; SER-427; THR-432 AND SER-628, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  10. "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach."
    Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S.
    Anal. Chem. 81:4493-4501(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  11. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
    Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
    Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Leukemic T-cell.
  12. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
    Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
    Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-628, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  13. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  14. "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
    Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
    Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-118; SER-464 AND SER-628, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

Entry informationi

Entry nameiPHAR4_HUMAN
AccessioniPrimary (citable) accession number: Q8IZ21
Secondary accession number(s): A2APK6
, B9ZVW0, D3DPM3, Q68DD4, Q6NUN6, Q8N384, Q9H395, Q9H6X0, Q9H8W6
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 15, 2007
Last sequence update: March 1, 2003
Last modified: October 29, 2014
This is version 97 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3