Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Uncharacterized protein KIAA2013

Gene

KIAA2013

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at protein leveli

Names & Taxonomyi

Protein namesi
Recommended name:
Uncharacterized protein KIAA2013
Gene namesi
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

HGNCiHGNC:28513. KIAA2013.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini41 – 589ExtracellularSequence analysisAdd BLAST549
Transmembranei590 – 610HelicalSequence analysisAdd BLAST21
Topological domaini611 – 634CytoplasmicSequence analysisAdd BLAST24

GO - Cellular componenti

  • integral component of membrane Source: UniProtKB-KW
  • membrane Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000116685.
PharmGKBiPA142671593.

Polymorphism and mutation databases

BioMutaiKIAA2013.
DMDMi74750773.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 40Sequence analysisAdd BLAST40
ChainiPRO_000029346841 – 634Uncharacterized protein KIAA2013Add BLAST594

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi363N-linked (GlcNAc...)Sequence analysis1

Keywords - PTMi

Glycoprotein

Proteomic databases

EPDiQ8IYS2.
MaxQBiQ8IYS2.
PaxDbiQ8IYS2.
PeptideAtlasiQ8IYS2.
PRIDEiQ8IYS2.

PTM databases

iPTMnetiQ8IYS2.
PhosphoSitePlusiQ8IYS2.
SwissPalmiQ8IYS2.

Expressioni

Gene expression databases

BgeeiENSG00000116685.
CleanExiHS_KIAA2013.
GenevisibleiQ8IYS2. HS.

Organism-specific databases

HPAiHPA052677.
HPA060536.

Interactioni

Protein-protein interaction databases

BioGridi124680. 55 interactors.
IntActiQ8IYS2. 29 interactors.
STRINGi9606.ENSP00000365756.

Structurei

3D structure databases

ProteinModelPortaliQ8IYS2.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Keywords - Domaini

Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG3778. Eukaryota.
ENOG410YFSK. LUCA.
GeneTreeiENSGT00390000007643.
HOGENOMiHOG000059256.
HOVERGENiHBG108051.
InParanoidiQ8IYS2.
OMAiHQRLWAQ.
OrthoDBiEOG091G0DWW.
PhylomeDBiQ8IYS2.
TreeFamiTF314999.

Family and domain databases

InterProiIPR018795. DUF2152.
[Graphical view]
PfamiPF10222. DUF2152. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8IYS2-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MWLQQRLKGL PGLLSSSWAR RLLCLLGLLL LLLWFGGSGA RRAAGGLHLL
60 70 80 90 100
PWSRGEPGAA EPSACLEAAT RAWRGLRERG EVVPLGPGVP ALVANGFLAL
110 120 130 140 150
DVAANRLWVT PGEREPAVAP DFVPFVQLRP LSALAEAGEA VLLLREGLLR
160 170 180 190 200
RVRCLQLGSP GPGPVAAGPG PASVSGLAAG SGRDCVLLQE DFLAHRGRPH
210 220 230 240 250
VYLQRIQLNN PTERVAALQT VGPTAGPAPK AFTSTLEKVG DHQFLLYSGR
260 270 280 290 300
SPPTPTGLVH LVVVAAKKLV NRLQVAPKTQ LDETVLWVVH VSGPINPQVL
310 320 330 340 350
KSKAAKELKA LQDLARKEML ELLDMPAAEL LQDHQLLWAQ LFSPGVEMKK
360 370 380 390 400
ITDTHTPSGL TVNLTLYYML SCSPAPLLSP SLSHRERDQM ESTLNYEDHC
410 420 430 440 450
FSGHATMHAE NLWPGRLSSV QQILQLSDLW RLTLQKRGCK GLVKVGAPGI
460 470 480 490 500
LQGMVLSFGG LQFTENHLQF QADPDVLHNS YALHGIRYKN DHINLAVLAD
510 520 530 540 550
AEGKPYLHVS VESRGQPVKI YACKAGCLDE PVELTSAPTG HTFSVMVTQP
560 570 580 590 600
ITPLLYISTD LTHLQDLRHT LHLKAILAHD EHMAQQDPGL PFLFWFSVAS
610 620 630
LITLFHLFLF KLIYNEYCGP GAKPLFRSKE DPSV
Length:634
Mass (Da):69,157
Last modified:March 1, 2003 - v1
Checksum:iCC63D7B1CDB33C5E
GO
Isoform 2 (identifier: Q8IYS2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     630-634: EDPSV → VGSRHLVETRGLGLALSPVSRKGLAWRGGVRPGQEWVS

Show »
Length:667
Mass (Da):72,681
Checksum:i6070CE966A25458C
GO

Sequence cautioni

The sequence BAC23109 differs from that shown. Reason: Erroneous initiation.Curated

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_026487630 – 634EDPSV → VGSRHLVETRGLGLALSPVS RKGLAWRGGVRPGQEWVS in isoform 2. 1 Publication5

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB095933 mRNA. Translation: BAC23109.1. Different initiation.
AL096840 Genomic DNA. Translation: CAI19081.1.
AL096840, AL021155 Genomic DNA. Translation: CAI19082.1.
AL021155, AL096840 Genomic DNA. Translation: CAI23397.1.
BC004501 mRNA. Translation: AAH04501.2.
BC035033 mRNA. Translation: AAH35033.1.
AL833891 mRNA. Translation: CAD38747.1.
CCDSiCCDS141.1. [Q8IYS2-1]
RefSeqiNP_612355.1. NM_138346.2. [Q8IYS2-1]
XP_005263588.1. XM_005263531.4. [Q8IYS2-2]
UniGeneiHs.520094.

Genome annotation databases

EnsembliENST00000376572; ENSP00000365756; ENSG00000116685. [Q8IYS2-1]
ENST00000376576; ENSP00000365760; ENSG00000116685. [Q8IYS2-2]
ENST00000616327; ENSP00000480577; ENSG00000116685. [Q8IYS2-1]
GeneIDi90231.
KEGGihsa:90231.
UCSCiuc001atk.4. human. [Q8IYS2-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB095933 mRNA. Translation: BAC23109.1. Different initiation.
AL096840 Genomic DNA. Translation: CAI19081.1.
AL096840, AL021155 Genomic DNA. Translation: CAI19082.1.
AL021155, AL096840 Genomic DNA. Translation: CAI23397.1.
BC004501 mRNA. Translation: AAH04501.2.
BC035033 mRNA. Translation: AAH35033.1.
AL833891 mRNA. Translation: CAD38747.1.
CCDSiCCDS141.1. [Q8IYS2-1]
RefSeqiNP_612355.1. NM_138346.2. [Q8IYS2-1]
XP_005263588.1. XM_005263531.4. [Q8IYS2-2]
UniGeneiHs.520094.

3D structure databases

ProteinModelPortaliQ8IYS2.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi124680. 55 interactors.
IntActiQ8IYS2. 29 interactors.
STRINGi9606.ENSP00000365756.

PTM databases

iPTMnetiQ8IYS2.
PhosphoSitePlusiQ8IYS2.
SwissPalmiQ8IYS2.

Polymorphism and mutation databases

BioMutaiKIAA2013.
DMDMi74750773.

Proteomic databases

EPDiQ8IYS2.
MaxQBiQ8IYS2.
PaxDbiQ8IYS2.
PeptideAtlasiQ8IYS2.
PRIDEiQ8IYS2.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000376572; ENSP00000365756; ENSG00000116685. [Q8IYS2-1]
ENST00000376576; ENSP00000365760; ENSG00000116685. [Q8IYS2-2]
ENST00000616327; ENSP00000480577; ENSG00000116685. [Q8IYS2-1]
GeneIDi90231.
KEGGihsa:90231.
UCSCiuc001atk.4. human. [Q8IYS2-1]

Organism-specific databases

CTDi90231.
GeneCardsiKIAA2013.
HGNCiHGNC:28513. KIAA2013.
HPAiHPA052677.
HPA060536.
neXtProtiNX_Q8IYS2.
OpenTargetsiENSG00000116685.
PharmGKBiPA142671593.
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG3778. Eukaryota.
ENOG410YFSK. LUCA.
GeneTreeiENSGT00390000007643.
HOGENOMiHOG000059256.
HOVERGENiHBG108051.
InParanoidiQ8IYS2.
OMAiHQRLWAQ.
OrthoDBiEOG091G0DWW.
PhylomeDBiQ8IYS2.
TreeFamiTF314999.

Miscellaneous databases

GenomeRNAii90231.
PROiQ8IYS2.

Gene expression databases

BgeeiENSG00000116685.
CleanExiHS_KIAA2013.
GenevisibleiQ8IYS2. HS.

Family and domain databases

InterProiIPR018795. DUF2152.
[Graphical view]
PfamiPF10222. DUF2152. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiK2013_HUMAN
AccessioniPrimary (citable) accession number: Q8IYS2
Secondary accession number(s): Q5JXC1
, Q8IVF8, Q8NDI7, Q9BSY1
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 10, 2007
Last sequence update: March 1, 2003
Last modified: November 2, 2016
This is version 99 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.