Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q8IYS2

- K2013_HUMAN

UniProt

Q8IYS2 - K2013_HUMAN

Protein

Uncharacterized protein KIAA2013

Gene

KIAA2013

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 3 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 80 (01 Oct 2014)
      Sequence version 1 (01 Mar 2003)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Uncharacterized protein KIAA2013
    Gene namesi
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 1

    Organism-specific databases

    HGNCiHGNC:28513. KIAA2013.

    Subcellular locationi

    GO - Cellular componenti

    1. integral component of membrane Source: UniProtKB-KW
    2. membrane Source: UniProtKB

    Keywords - Cellular componenti

    Membrane

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA142671593.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Signal peptidei1 – 4040Sequence AnalysisAdd
    BLAST
    Chaini41 – 634594Uncharacterized protein KIAA2013PRO_0000293468Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Glycosylationi363 – 3631N-linked (GlcNAc...)Sequence Analysis

    Keywords - PTMi

    Glycoprotein

    Proteomic databases

    MaxQBiQ8IYS2.
    PaxDbiQ8IYS2.
    PRIDEiQ8IYS2.

    PTM databases

    PhosphoSiteiQ8IYS2.

    Expressioni

    Gene expression databases

    BgeeiQ8IYS2.
    CleanExiHS_KIAA2013.
    GenevestigatoriQ8IYS2.

    Organism-specific databases

    HPAiHPA052677.

    Interactioni

    Protein-protein interaction databases

    BioGridi124680. 7 interactions.
    IntActiQ8IYS2. 2 interactions.
    STRINGi9606.ENSP00000365756.

    Structurei

    3D structure databases

    ProteinModelPortaliQ8IYS2.
    ModBaseiSearch...
    MobiDBiSearch...

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini41 – 589549ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini611 – 63424CytoplasmicSequence AnalysisAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei590 – 61021HelicalSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Keywords - Domaini

    Signal, Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiNOG320558.
    HOGENOMiHOG000059256.
    HOVERGENiHBG108051.
    OMAiNRLWVTP.
    OrthoDBiEOG74BJRH.
    PhylomeDBiQ8IYS2.
    TreeFamiTF314999.

    Family and domain databases

    InterProiIPR018795. DUF2152.
    [Graphical view]
    PfamiPF10222. DUF2152. 1 hit.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q8IYS2-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MWLQQRLKGL PGLLSSSWAR RLLCLLGLLL LLLWFGGSGA RRAAGGLHLL    50
    PWSRGEPGAA EPSACLEAAT RAWRGLRERG EVVPLGPGVP ALVANGFLAL 100
    DVAANRLWVT PGEREPAVAP DFVPFVQLRP LSALAEAGEA VLLLREGLLR 150
    RVRCLQLGSP GPGPVAAGPG PASVSGLAAG SGRDCVLLQE DFLAHRGRPH 200
    VYLQRIQLNN PTERVAALQT VGPTAGPAPK AFTSTLEKVG DHQFLLYSGR 250
    SPPTPTGLVH LVVVAAKKLV NRLQVAPKTQ LDETVLWVVH VSGPINPQVL 300
    KSKAAKELKA LQDLARKEML ELLDMPAAEL LQDHQLLWAQ LFSPGVEMKK 350
    ITDTHTPSGL TVNLTLYYML SCSPAPLLSP SLSHRERDQM ESTLNYEDHC 400
    FSGHATMHAE NLWPGRLSSV QQILQLSDLW RLTLQKRGCK GLVKVGAPGI 450
    LQGMVLSFGG LQFTENHLQF QADPDVLHNS YALHGIRYKN DHINLAVLAD 500
    AEGKPYLHVS VESRGQPVKI YACKAGCLDE PVELTSAPTG HTFSVMVTQP 550
    ITPLLYISTD LTHLQDLRHT LHLKAILAHD EHMAQQDPGL PFLFWFSVAS 600
    LITLFHLFLF KLIYNEYCGP GAKPLFRSKE DPSV 634
    Length:634
    Mass (Da):69,157
    Last modified:March 1, 2003 - v1
    Checksum:iCC63D7B1CDB33C5E
    GO
    Isoform 2 (identifier: Q8IYS2-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         630-634: EDPSV → VGSRHLVETRGLGLALSPVSRKGLAWRGGVRPGQEWVS

    Show »
    Length:667
    Mass (Da):72,681
    Checksum:i6070CE966A25458C
    GO

    Sequence cautioni

    The sequence BAC23109.1 differs from that shown. Reason: Erroneous initiation.

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei630 – 6345EDPSV → VGSRHLVETRGLGLALSPVS RKGLAWRGGVRPGQEWVS in isoform 2. 1 PublicationVSP_026487

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB095933 mRNA. Translation: BAC23109.1. Different initiation.
    AL096840 Genomic DNA. Translation: CAI19081.1.
    AL096840, AL021155 Genomic DNA. Translation: CAI19082.1.
    AL021155, AL096840 Genomic DNA. Translation: CAI23397.1.
    BC004501 mRNA. Translation: AAH04501.2.
    BC035033 mRNA. Translation: AAH35033.1.
    AL833891 mRNA. Translation: CAD38747.1.
    CCDSiCCDS141.1. [Q8IYS2-1]
    RefSeqiNP_612355.1. NM_138346.2. [Q8IYS2-1]
    XP_005263588.1. XM_005263531.2. [Q8IYS2-2]
    UniGeneiHs.520094.

    Genome annotation databases

    EnsembliENST00000376572; ENSP00000365756; ENSG00000116685. [Q8IYS2-1]
    ENST00000376576; ENSP00000365760; ENSG00000116685. [Q8IYS2-2]
    GeneIDi90231.
    KEGGihsa:90231.
    UCSCiuc001atk.3. human. [Q8IYS2-1]
    uc001atl.2. human. [Q8IYS2-2]

    Polymorphism databases

    DMDMi74750773.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB095933 mRNA. Translation: BAC23109.1 . Different initiation.
    AL096840 Genomic DNA. Translation: CAI19081.1 .
    AL096840 , AL021155 Genomic DNA. Translation: CAI19082.1 .
    AL021155 , AL096840 Genomic DNA. Translation: CAI23397.1 .
    BC004501 mRNA. Translation: AAH04501.2 .
    BC035033 mRNA. Translation: AAH35033.1 .
    AL833891 mRNA. Translation: CAD38747.1 .
    CCDSi CCDS141.1. [Q8IYS2-1 ]
    RefSeqi NP_612355.1. NM_138346.2. [Q8IYS2-1 ]
    XP_005263588.1. XM_005263531.2. [Q8IYS2-2 ]
    UniGenei Hs.520094.

    3D structure databases

    ProteinModelPortali Q8IYS2.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 124680. 7 interactions.
    IntActi Q8IYS2. 2 interactions.
    STRINGi 9606.ENSP00000365756.

    PTM databases

    PhosphoSitei Q8IYS2.

    Polymorphism databases

    DMDMi 74750773.

    Proteomic databases

    MaxQBi Q8IYS2.
    PaxDbi Q8IYS2.
    PRIDEi Q8IYS2.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000376572 ; ENSP00000365756 ; ENSG00000116685 . [Q8IYS2-1 ]
    ENST00000376576 ; ENSP00000365760 ; ENSG00000116685 . [Q8IYS2-2 ]
    GeneIDi 90231.
    KEGGi hsa:90231.
    UCSCi uc001atk.3. human. [Q8IYS2-1 ]
    uc001atl.2. human. [Q8IYS2-2 ]

    Organism-specific databases

    CTDi 90231.
    GeneCardsi GC01M011979.
    HGNCi HGNC:28513. KIAA2013.
    HPAi HPA052677.
    neXtProti NX_Q8IYS2.
    PharmGKBi PA142671593.
    HUGEi Search...
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG320558.
    HOGENOMi HOG000059256.
    HOVERGENi HBG108051.
    OMAi NRLWVTP.
    OrthoDBi EOG74BJRH.
    PhylomeDBi Q8IYS2.
    TreeFami TF314999.

    Miscellaneous databases

    GenomeRNAii 90231.
    NextBioi 76607.

    Gene expression databases

    Bgeei Q8IYS2.
    CleanExi HS_KIAA2013.
    Genevestigatori Q8IYS2.

    Family and domain databases

    InterProi IPR018795. DUF2152.
    [Graphical view ]
    Pfami PF10222. DUF2152. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "The nucleotide sequence of a long cDNA clone isolated from human."
      Nagase T., Kikuno R., Ohara O.
      Submitted (NOV-2002) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
      Tissue: Brain.
    2. "The DNA sequence and biological annotation of human chromosome 1."
      Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K.
      , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
      Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Brain and Ovary.
    4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 349-634 (ISOFORM 1).
      Tissue: Testis.

    Entry informationi

    Entry nameiK2013_HUMAN
    AccessioniPrimary (citable) accession number: Q8IYS2
    Secondary accession number(s): Q5JXC1
    , Q8IVF8, Q8NDI7, Q9BSY1
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: July 10, 2007
    Last sequence update: March 1, 2003
    Last modified: October 1, 2014
    This is version 80 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 1
      Human chromosome 1: entries, gene names and cross-references to MIM

    External Data

    Dasty 3