Q8IYS2 (K2013_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 70.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Uncharacterized protein KIAA2013 | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Reference proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 634 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Subcellular location | Membrane; Single-pass type I membrane protein Potential. |
| Sequence caution | The sequence BAC23109.1 differs from that shown. Reason: Erroneous initiation. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Membrane |
| Coding sequence diversity | Alternative splicing |
| Domain | Signal Transmembrane Transmembrane helix |
| PTM | Glycoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Cellular_component | integral to membrane Inferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q8IYS2-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q8IYS2-2) The sequence of this isoform differs from the canonical sequence as follows: 630-634: EDPSV → VGSRHLVETRGLGLALSPVSRKGLAWRGGVRPGQEWVS |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 40 | 40 | Potential | ||||||
| Chain | 41 – 634 | 594 | Uncharacterized protein KIAA2013 | PRO_0000293468 | |||||
Regions | |||||||||
| Topological domain | 41 – 589 | 549 | Extracellular Potential | ||||||
| Transmembrane | 590 – 610 | 21 | Helical; Potential | ||||||
| Topological domain | 611 – 634 | 24 | Cytoplasmic Potential | ||||||
Amino acid modifications | |||||||||
| Glycosylation | 363 | 1 | N-linked (GlcNAc...) Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 630 – 634 | 5 | EDPSV → VGSRHLVETRGLGLALSPVS RKGLAWRGGVRPGQEWVS in isoform 2. | VSP_026487 | |||||
Sequences
| ||||||||||||||||||||||||
References
| [1] | "The nucleotide sequence of a long cDNA clone isolated from human." Nagase T., Kikuno R., Ohara O. Submitted (NOV-2002) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Brain. |
| [2] | "The DNA sequence and biological annotation of human chromosome 1." Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K. Bentley D.R.Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [3] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Brain and Ovary. |
| [4] | "The full-ORF clone resource of the German cDNA consortium." Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I. BMC Genomics 8:399-399(2007) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 349-634 (ISOFORM 1). Tissue: Testis. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AB095933 mRNA. Translation: BAC23109.1. Different initiation. AL096840 Genomic DNA. Translation: CAI19081.1. AL096840, AL021155 Genomic DNA. Translation: CAI19082.1. AL021155, AL096840 Genomic DNA. Translation: CAI23397.1. BC004501 mRNA. Translation: AAH04501.2. BC035033 mRNA. Translation: AAH35033.1. AL833891 mRNA. Translation: CAD38747.1. |
| IPI | IPI00217007. IPI00217853. |
| RefSeq | NP_612355.1. NM_138346.2. |
| UniGene | Hs.520094. |
3D structure databases | |
| ProteinModelPortal | Q8IYS2. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q8IYS2. 2 interactions. |
| STRING | 9606.ENSP00000365756. |
PTM databases | |
| PhosphoSite | Q8IYS2. |
Polymorphism databases | |
| DMDM | 74750773. |
Proteomic databases | |
| PaxDb | Q8IYS2. |
| PRIDE | Q8IYS2. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000376572; ENSP00000365756; ENSG00000116685. ENST00000376576; ENSP00000365760; ENSG00000116685. |
| GeneID | 90231. |
| KEGG | hsa:90231. |
| UCSC | uc001atk.3. human. uc001atl.2. human. |
Organism-specific databases | |
| CTD | 90231. |
| GeneCards | GC01M011971. |
| HGNC | HGNC:28513. KIAA2013. |
| HPA | HPA052677. |
| neXtProt | NX_Q8IYS2. |
| PharmGKB | PA142671593. |
| HUGE | Search... |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG320558. |
| HOGENOM | HOG000059256. |
| HOVERGEN | HBG108051. |
| OMA | RDCVLLQ. |
| OrthoDB | EOG46WZ85. |
Gene expression databases | |
| Bgee | Q8IYS2. |
| CleanEx | HS_KIAA2013. |
| Genevestigator | Q8IYS2. |
Family and domain databases | |
| InterPro | IPR018795. DUF2152. [Graphical view] |
| Pfam | PF10222. DUF2152. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 90231. |
| NextBio | 76607. |
Entry information
| Entry name | K2013_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q8IYS2 Secondary accession number(s): Q5JXC1 Q9BSY1 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 1 Human chromosome 1: entries, gene names and cross-references to MIM |

Clusters with
