Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q8IYS2 (K2013_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 79. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (1) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Uncharacterized protein KIAA2013
Gene names
Name:KIAA2013
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length634 AA.
Sequence statusComplete.
Sequence processingThe displayed sequence is further processed into a mature form.
Protein existenceEvidence at transcript level

General annotation (Comments)

Subcellular location

Membrane; Single-pass type I membrane protein Potential.

Sequence caution

The sequence BAC23109.1 differs from that shown. Reason: Erroneous initiation.

Ontologies

Keywords
   Cellular componentMembrane
   Coding sequence diversityAlternative splicing
   DomainSignal
Transmembrane
Transmembrane helix
   PTMGlycoprotein
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Cellular_componentintegral component of membrane

Inferred from electronic annotation. Source: UniProtKB-KW

Complete GO annotation...

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q8IYS2-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q8IYS2-2)

The sequence of this isoform differs from the canonical sequence as follows:
     630-634: EDPSV → VGSRHLVETRGLGLALSPVSRKGLAWRGGVRPGQEWVS

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Signal peptide1 – 4040 Potential
Chain41 – 634594Uncharacterized protein KIAA2013
PRO_0000293468

Regions

Topological domain41 – 589549Extracellular Potential
Transmembrane590 – 61021Helical; Potential
Topological domain611 – 63424Cytoplasmic Potential

Amino acid modifications

Glycosylation3631N-linked (GlcNAc...) Potential

Natural variations

Alternative sequence630 – 6345EDPSV → VGSRHLVETRGLGLALSPVS RKGLAWRGGVRPGQEWVS in isoform 2.
VSP_026487

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified March 1, 2003. Version 1.
Checksum: CC63D7B1CDB33C5E

FASTA63469,157
        10         20         30         40         50         60 
MWLQQRLKGL PGLLSSSWAR RLLCLLGLLL LLLWFGGSGA RRAAGGLHLL PWSRGEPGAA 

        70         80         90        100        110        120 
EPSACLEAAT RAWRGLRERG EVVPLGPGVP ALVANGFLAL DVAANRLWVT PGEREPAVAP 

       130        140        150        160        170        180 
DFVPFVQLRP LSALAEAGEA VLLLREGLLR RVRCLQLGSP GPGPVAAGPG PASVSGLAAG 

       190        200        210        220        230        240 
SGRDCVLLQE DFLAHRGRPH VYLQRIQLNN PTERVAALQT VGPTAGPAPK AFTSTLEKVG 

       250        260        270        280        290        300 
DHQFLLYSGR SPPTPTGLVH LVVVAAKKLV NRLQVAPKTQ LDETVLWVVH VSGPINPQVL 

       310        320        330        340        350        360 
KSKAAKELKA LQDLARKEML ELLDMPAAEL LQDHQLLWAQ LFSPGVEMKK ITDTHTPSGL 

       370        380        390        400        410        420 
TVNLTLYYML SCSPAPLLSP SLSHRERDQM ESTLNYEDHC FSGHATMHAE NLWPGRLSSV 

       430        440        450        460        470        480 
QQILQLSDLW RLTLQKRGCK GLVKVGAPGI LQGMVLSFGG LQFTENHLQF QADPDVLHNS 

       490        500        510        520        530        540 
YALHGIRYKN DHINLAVLAD AEGKPYLHVS VESRGQPVKI YACKAGCLDE PVELTSAPTG 

       550        560        570        580        590        600 
HTFSVMVTQP ITPLLYISTD LTHLQDLRHT LHLKAILAHD EHMAQQDPGL PFLFWFSVAS 

       610        620        630 
LITLFHLFLF KLIYNEYCGP GAKPLFRSKE DPSV 

« Hide

Isoform 2 [UniParc].

Checksum: 6070CE966A25458C
Show »

FASTA66772,681

References

[1]"The nucleotide sequence of a long cDNA clone isolated from human."
Nagase T., Kikuno R., Ohara O.
Submitted (NOV-2002) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
Tissue: Brain.
[2]"The DNA sequence and biological annotation of human chromosome 1."
Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K. expand/collapse author list , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[3]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Brain and Ovary.
[4]"The full-ORF clone resource of the German cDNA consortium."
Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I.
BMC Genomics 8:399-399(2007) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 349-634 (ISOFORM 1).
Tissue: Testis.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AB095933 mRNA. Translation: BAC23109.1. Different initiation.
AL096840 Genomic DNA. Translation: CAI19081.1.
AL096840, AL021155 Genomic DNA. Translation: CAI19082.1.
AL021155, AL096840 Genomic DNA. Translation: CAI23397.1.
BC004501 mRNA. Translation: AAH04501.2.
BC035033 mRNA. Translation: AAH35033.1.
AL833891 mRNA. Translation: CAD38747.1.
CCDSCCDS141.1. [Q8IYS2-1]
RefSeqNP_612355.1. NM_138346.2. [Q8IYS2-1]
XP_005263588.1. XM_005263531.2. [Q8IYS2-2]
UniGeneHs.520094.

3D structure databases

ProteinModelPortalQ8IYS2.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid124680. 7 interactions.
IntActQ8IYS2. 2 interactions.
STRING9606.ENSP00000365756.

PTM databases

PhosphoSiteQ8IYS2.

Polymorphism databases

DMDM74750773.

Proteomic databases

MaxQBQ8IYS2.
PaxDbQ8IYS2.
PRIDEQ8IYS2.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000376572; ENSP00000365756; ENSG00000116685. [Q8IYS2-1]
ENST00000376576; ENSP00000365760; ENSG00000116685. [Q8IYS2-2]
GeneID90231.
KEGGhsa:90231.
UCSCuc001atk.3. human. [Q8IYS2-1]
uc001atl.2. human. [Q8IYS2-2]

Organism-specific databases

CTD90231.
GeneCardsGC01M011979.
HGNCHGNC:28513. KIAA2013.
HPAHPA052677.
neXtProtNX_Q8IYS2.
PharmGKBPA142671593.
HUGESearch...
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG320558.
HOGENOMHOG000059256.
HOVERGENHBG108051.
OMANRLWVTP.
OrthoDBEOG74BJRH.
PhylomeDBQ8IYS2.
TreeFamTF314999.

Gene expression databases

BgeeQ8IYS2.
CleanExHS_KIAA2013.
GenevestigatorQ8IYS2.

Family and domain databases

InterProIPR018795. DUF2152.
[Graphical view]
PfamPF10222. DUF2152. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

GenomeRNAi90231.
NextBio76607.

Entry information

Entry nameK2013_HUMAN
AccessionPrimary (citable) accession number: Q8IYS2
Secondary accession number(s): Q5JXC1 expand/collapse secondary AC list , Q8IVF8, Q8NDI7, Q9BSY1
Entry history
Integrated into UniProtKB/Swiss-Prot: July 10, 2007
Last sequence update: March 1, 2003
Last modified: July 9, 2014
This is version 79 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

Human chromosome 1

Human chromosome 1: entries, gene names and cross-references to MIM