Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q8IYS2

- K2013_HUMAN

UniProt

Q8IYS2 - K2013_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Uncharacterized protein KIAA2013

Gene

KIAA2013

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 3 out of 5- Experimental evidence at transcript leveli

Names & Taxonomyi

Protein namesi
Recommended name:
Uncharacterized protein KIAA2013
Gene namesi
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 1

Organism-specific databases

HGNCiHGNC:28513. KIAA2013.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini41 – 589549ExtracellularSequence AnalysisAdd
BLAST
Transmembranei590 – 61021HelicalSequence AnalysisAdd
BLAST
Topological domaini611 – 63424CytoplasmicSequence AnalysisAdd
BLAST

GO - Cellular componenti

  1. integral component of membrane Source: UniProtKB-KW
  2. membrane Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA142671593.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 4040Sequence AnalysisAdd
BLAST
Chaini41 – 634594Uncharacterized protein KIAA2013PRO_0000293468Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi363 – 3631N-linked (GlcNAc...)Sequence Analysis

Keywords - PTMi

Glycoprotein

Proteomic databases

MaxQBiQ8IYS2.
PaxDbiQ8IYS2.
PRIDEiQ8IYS2.

PTM databases

PhosphoSiteiQ8IYS2.

Expressioni

Gene expression databases

BgeeiQ8IYS2.
CleanExiHS_KIAA2013.
GenevestigatoriQ8IYS2.

Organism-specific databases

HPAiHPA052677.

Interactioni

Protein-protein interaction databases

BioGridi124680. 15 interactions.
IntActiQ8IYS2. 2 interactions.
STRINGi9606.ENSP00000365756.

Structurei

3D structure databases

ProteinModelPortaliQ8IYS2.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Keywords - Domaini

Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG320558.
GeneTreeiENSGT00390000007643.
HOGENOMiHOG000059256.
HOVERGENiHBG108051.
InParanoidiQ8IYS2.
OMAiNRLWVTP.
OrthoDBiEOG74BJRH.
PhylomeDBiQ8IYS2.
TreeFamiTF314999.

Family and domain databases

InterProiIPR018795. DUF2152.
[Graphical view]
PfamiPF10222. DUF2152. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q8IYS2-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MWLQQRLKGL PGLLSSSWAR RLLCLLGLLL LLLWFGGSGA RRAAGGLHLL
60 70 80 90 100
PWSRGEPGAA EPSACLEAAT RAWRGLRERG EVVPLGPGVP ALVANGFLAL
110 120 130 140 150
DVAANRLWVT PGEREPAVAP DFVPFVQLRP LSALAEAGEA VLLLREGLLR
160 170 180 190 200
RVRCLQLGSP GPGPVAAGPG PASVSGLAAG SGRDCVLLQE DFLAHRGRPH
210 220 230 240 250
VYLQRIQLNN PTERVAALQT VGPTAGPAPK AFTSTLEKVG DHQFLLYSGR
260 270 280 290 300
SPPTPTGLVH LVVVAAKKLV NRLQVAPKTQ LDETVLWVVH VSGPINPQVL
310 320 330 340 350
KSKAAKELKA LQDLARKEML ELLDMPAAEL LQDHQLLWAQ LFSPGVEMKK
360 370 380 390 400
ITDTHTPSGL TVNLTLYYML SCSPAPLLSP SLSHRERDQM ESTLNYEDHC
410 420 430 440 450
FSGHATMHAE NLWPGRLSSV QQILQLSDLW RLTLQKRGCK GLVKVGAPGI
460 470 480 490 500
LQGMVLSFGG LQFTENHLQF QADPDVLHNS YALHGIRYKN DHINLAVLAD
510 520 530 540 550
AEGKPYLHVS VESRGQPVKI YACKAGCLDE PVELTSAPTG HTFSVMVTQP
560 570 580 590 600
ITPLLYISTD LTHLQDLRHT LHLKAILAHD EHMAQQDPGL PFLFWFSVAS
610 620 630
LITLFHLFLF KLIYNEYCGP GAKPLFRSKE DPSV
Length:634
Mass (Da):69,157
Last modified:March 1, 2003 - v1
Checksum:iCC63D7B1CDB33C5E
GO
Isoform 2 (identifier: Q8IYS2-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     630-634: EDPSV → VGSRHLVETRGLGLALSPVSRKGLAWRGGVRPGQEWVS

Show »
Length:667
Mass (Da):72,681
Checksum:i6070CE966A25458C
GO

Sequence cautioni

The sequence BAC23109.1 differs from that shown. Reason: Erroneous initiation. Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei630 – 6345EDPSV → VGSRHLVETRGLGLALSPVS RKGLAWRGGVRPGQEWVS in isoform 2. 1 PublicationVSP_026487

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB095933 mRNA. Translation: BAC23109.1. Different initiation.
AL096840 Genomic DNA. Translation: CAI19081.1.
AL096840, AL021155 Genomic DNA. Translation: CAI19082.1.
AL021155, AL096840 Genomic DNA. Translation: CAI23397.1.
BC004501 mRNA. Translation: AAH04501.2.
BC035033 mRNA. Translation: AAH35033.1.
AL833891 mRNA. Translation: CAD38747.1.
CCDSiCCDS141.1. [Q8IYS2-1]
RefSeqiNP_612355.1. NM_138346.2. [Q8IYS2-1]
XP_005263588.1. XM_005263531.2. [Q8IYS2-2]
UniGeneiHs.520094.

Genome annotation databases

EnsembliENST00000376572; ENSP00000365756; ENSG00000116685. [Q8IYS2-1]
ENST00000376576; ENSP00000365760; ENSG00000116685. [Q8IYS2-2]
ENST00000616327; ENSP00000480577; ENSG00000116685. [Q8IYS2-1]
GeneIDi90231.
KEGGihsa:90231.
UCSCiuc001atk.3. human. [Q8IYS2-1]
uc001atl.2. human. [Q8IYS2-2]

Polymorphism databases

DMDMi74750773.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB095933 mRNA. Translation: BAC23109.1 . Different initiation.
AL096840 Genomic DNA. Translation: CAI19081.1 .
AL096840 , AL021155 Genomic DNA. Translation: CAI19082.1 .
AL021155 , AL096840 Genomic DNA. Translation: CAI23397.1 .
BC004501 mRNA. Translation: AAH04501.2 .
BC035033 mRNA. Translation: AAH35033.1 .
AL833891 mRNA. Translation: CAD38747.1 .
CCDSi CCDS141.1. [Q8IYS2-1 ]
RefSeqi NP_612355.1. NM_138346.2. [Q8IYS2-1 ]
XP_005263588.1. XM_005263531.2. [Q8IYS2-2 ]
UniGenei Hs.520094.

3D structure databases

ProteinModelPortali Q8IYS2.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 124680. 15 interactions.
IntActi Q8IYS2. 2 interactions.
STRINGi 9606.ENSP00000365756.

PTM databases

PhosphoSitei Q8IYS2.

Polymorphism databases

DMDMi 74750773.

Proteomic databases

MaxQBi Q8IYS2.
PaxDbi Q8IYS2.
PRIDEi Q8IYS2.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000376572 ; ENSP00000365756 ; ENSG00000116685 . [Q8IYS2-1 ]
ENST00000376576 ; ENSP00000365760 ; ENSG00000116685 . [Q8IYS2-2 ]
ENST00000616327 ; ENSP00000480577 ; ENSG00000116685 . [Q8IYS2-1 ]
GeneIDi 90231.
KEGGi hsa:90231.
UCSCi uc001atk.3. human. [Q8IYS2-1 ]
uc001atl.2. human. [Q8IYS2-2 ]

Organism-specific databases

CTDi 90231.
GeneCardsi GC01M011979.
HGNCi HGNC:28513. KIAA2013.
HPAi HPA052677.
neXtProti NX_Q8IYS2.
PharmGKBi PA142671593.
HUGEi Search...
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG320558.
GeneTreei ENSGT00390000007643.
HOGENOMi HOG000059256.
HOVERGENi HBG108051.
InParanoidi Q8IYS2.
OMAi NRLWVTP.
OrthoDBi EOG74BJRH.
PhylomeDBi Q8IYS2.
TreeFami TF314999.

Miscellaneous databases

GenomeRNAii 90231.
NextBioi 76607.

Gene expression databases

Bgeei Q8IYS2.
CleanExi HS_KIAA2013.
Genevestigatori Q8IYS2.

Family and domain databases

InterProi IPR018795. DUF2152.
[Graphical view ]
Pfami PF10222. DUF2152. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

  1. "The nucleotide sequence of a long cDNA clone isolated from human."
    Nagase T., Kikuno R., Ohara O.
    Submitted (NOV-2002) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Brain.
  2. "The DNA sequence and biological annotation of human chromosome 1."
    Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K.
    , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
    Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Brain and Ovary.
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 349-634 (ISOFORM 1).
    Tissue: Testis.

Entry informationi

Entry nameiK2013_HUMAN
AccessioniPrimary (citable) accession number: Q8IYS2
Secondary accession number(s): Q5JXC1
, Q8IVF8, Q8NDI7, Q9BSY1
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 10, 2007
Last sequence update: March 1, 2003
Last modified: October 29, 2014
This is version 81 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM

External Data

Dasty 3