Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Copine-9

Gene

CPNE9

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

Probable calcium-dependent phospholipid-binding protein that may play a role in calcium-mediated intracellular processes (By similarity). Plays a role in dendrite formation by melanocytes (PubMed:23999003).By similarity1 Publication

GO - Biological processi

  • positive regulation of dendrite extension Source: UniProtKB

Keywordsi

Biological processDifferentiation

Names & Taxonomyi

Protein namesi
Recommended name:
Copine-9Curated
Alternative name(s):
Copine IXImported
Gene namesi
Name:CPNE9Imported
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 3

Organism-specific databases

EuPathDBiHostDB:ENSG00000144550.12.
HGNCiHGNC:24336. CPNE9.

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000144550.
PharmGKBiPA142672082.

Polymorphism and mutation databases

BioMutaiCPNE9.
DMDMi300669696.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002775831 – 553Copine-9Add BLAST553

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi95N-linked (GlcNAc...) asparagine1 Publication1

Keywords - PTMi

Glycoprotein

Proteomic databases

EPDiQ8IYJ1.
MaxQBiQ8IYJ1.
PaxDbiQ8IYJ1.
PeptideAtlasiQ8IYJ1.
PRIDEiQ8IYJ1.

PTM databases

iPTMnetiQ8IYJ1.
PhosphoSitePlusiQ8IYJ1.

Expressioni

Tissue specificityi

Expressed in melanocytes (PubMed:23999003).1 Publication

Gene expression databases

BgeeiENSG00000144550.
CleanExiHS_CPNE9.
ExpressionAtlasiQ8IYJ1. baseline and differential.
GenevisibleiQ8IYJ1. HS.

Interactioni

Protein-protein interaction databases

BioGridi127405. 1 interactor.
STRINGi9606.ENSP00000373343.

Structurei

3D structure databases

ProteinModelPortaliQ8IYJ1.
SMRiQ8IYJ1.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini1 – 107C2 1PROSITE-ProRule annotationAdd BLAST107
Domaini134 – 239C2 2PROSITE-ProRule annotationAdd BLAST106
Domaini299 – 500VWFAPROSITE-ProRule annotationAdd BLAST202

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi262 – 268Poly-Lys7
Compositional biasi536 – 541Poly-Pro6

Sequence similaritiesi

Belongs to the copine family.Curated

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiKOG1327. Eukaryota.
ENOG410XPC8. LUCA.
GeneTreeiENSGT00760000119085.
HOGENOMiHOG000220898.
HOVERGENiHBG066841.
InParanoidiQ8IYJ1.
OMAiRAQSQFT.
OrthoDBiEOG091G05IT.
PhylomeDBiQ8IYJ1.
TreeFamiTF316419.

Family and domain databases

CDDicd01459. vWA_copine_like. 1 hit.
Gene3Di2.60.40.150. 2 hits.
3.40.50.410. 1 hit.
InterProiView protein in InterPro
IPR000008. C2_dom.
IPR035892. C2_domain_sf.
IPR010734. Copine.
IPR002035. VWF_A.
IPR036465. vWFA_dom_sf.
PfamiView protein in Pfam
PF00168. C2. 2 hits.
PF07002. Copine. 1 hit.
SMARTiView protein in SMART
SM00239. C2. 2 hits.
SM00327. VWA. 1 hit.
SUPFAMiSSF49562. SSF49562. 2 hits.
SSF53300. SSF53300. 1 hit.
PROSITEiView protein in PROSITE
PS50004. C2. 2 hits.
PS50234. VWFA. 1 hit.

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8IYJ1-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSLGGASERS VPATKIEITV SCRNLLDLDT FSKSDPMVVL YTQSRASQEW
60 70 80 90 100
REFGRTEVID NTLNPDFVRK FVLDYFFEEK QNLRFDVYNV DSKTNISKPK
110 120 130 140 150
DFLGQAFLAL GEVIGGQGSR VERTLTGVPG KKCGTILLTA EELSNCRDIA
160 170 180 190 200
TMQLCANKLD KKDFFGKSDP FLVFYRSNED GTFTICHKTE VVKNTLNPVW
210 220 230 240 250
QPFSIPVRAL CNGDYDRTVK IDVYDWDRDG SHDFIGEFTT SYRELSKAQN
260 270 280 290 300
QFTVYEVLNP RKKCKKKKYV NSGTVTLLSF SVDSEFTFVD YIKGGTQLNF
310 320 330 340 350
TVAIDFTASN GNPLQPTSLH YMSPYQLSAY AMALKAVGEI IQDYDSDKLF
360 370 380 390 400
PAYGFGAKLP PEGRISHQFP LNNNDEDPNC AGIEGVLESY FQSLRTVQLY
410 420 430 440 450
GPTYFAPVIN QVARAAAKIS DGSQYYVLLI ITDGVISDMT QTKEAIVSAS
460 470 480 490 500
SLPMSIIIVG VGPAMFEAME ELDGDDVRVS SRGRYAERDI VQFVPFRDYV
510 520 530 540 550
DRSGNQVLSM ARLAKDVLAE IPEQLLSYMR TRDIQPRPPP PANPSPIPAP

EQP
Length:553
Mass (Da):61,864
Last modified:July 13, 2010 - v3
Checksum:iB57802E3DBFFF579
GO
Isoform 2 (identifier: Q8IYJ1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     493-553: FVPFRDYVDRSGNQVLSMARLAKDVLAEIPEQLLSYMRTRDIQPRPPPPANPSPIPAPEQP → EGCCSLGTSVV

Show »
Length:503
Mass (Da):56,034
Checksum:iB289BF825FE75602
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti100Missing in EAW63970 (Ref. 2) Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_039523493 – 553FVPFR…APEQP → EGCCSLGTSVV in isoform 2. 1 PublicationAdd BLAST61

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AC022382 Genomic DNA. No translation available.
CH471055 Genomic DNA. Translation: EAW63970.1.
BC130375 mRNA. Translation: AAI30376.1.
BC035735 mRNA. Translation: AAH35735.2.
CCDSiCCDS2574.2. [Q8IYJ1-1]
CCDS77695.1. [Q8IYJ1-2]
RefSeqiNP_001295317.1. NM_001308388.1.
NP_705899.2. NM_153635.2. [Q8IYJ1-1]
UniGeneiHs.121335.

Genome annotation databases

EnsembliENST00000383831; ENSP00000373342; ENSG00000144550. [Q8IYJ1-2]
ENST00000383832; ENSP00000373343; ENSG00000144550. [Q8IYJ1-1]
GeneIDi151835.
KEGGihsa:151835.
UCSCiuc062gli.1. human. [Q8IYJ1-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiCPNE9_HUMAN
AccessioniPrimary (citable) accession number: Q8IYJ1
Secondary accession number(s): A1L430, A6NDX6, A8MSP8
Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 6, 2007
Last sequence update: July 13, 2010
Last modified: October 25, 2017
This is version 105 of the entry and version 3 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families