Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Copine-9

Gene

CPNE9

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

Probable calcium-dependent phospholipid-binding protein that may play a role in calcium-mediated intracellular processes (By similarity). Plays a role in dendrite formation by melanocytes (PubMed:23999003).By similarity1 Publication

GO - Biological processi

  • positive regulation of dendrite extension Source: UniProtKB
Complete GO annotation...

Keywords - Biological processi

Differentiation

Names & Taxonomyi

Protein namesi
Recommended name:
Copine-9Curated
Alternative name(s):
Copine IXImported
Gene namesi
Name:CPNE9Imported
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 3

Organism-specific databases

HGNCiHGNC:24336. CPNE9.

Subcellular locationi

GO - Cellular componenti

  • extracellular exosome Source: UniProtKB
  • extracellular space Source: UniProtKB
Complete GO annotation...

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA142672082.

Polymorphism and mutation databases

BioMutaiCPNE9.
DMDMi300669696.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 553553Copine-9PRO_0000277583Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi95 – 951N-linked (GlcNAc...)1 Publication

Keywords - PTMi

Glycoprotein

Proteomic databases

EPDiQ8IYJ1.
MaxQBiQ8IYJ1.
PaxDbiQ8IYJ1.
PeptideAtlasiQ8IYJ1.
PRIDEiQ8IYJ1.

PTM databases

iPTMnetiQ8IYJ1.
PhosphoSiteiQ8IYJ1.

Expressioni

Tissue specificityi

Expressed in melanocytes (PubMed:23999003).1 Publication

Gene expression databases

BgeeiQ8IYJ1.
CleanExiHS_CPNE9.
ExpressionAtlasiQ8IYJ1. baseline and differential.
GenevisibleiQ8IYJ1. HS.

Organism-specific databases

HPAiHPA049858.

Interactioni

Protein-protein interaction databases

BioGridi127405. 1 interaction.
STRINGi9606.ENSP00000373343.

Structurei

3D structure databases

ProteinModelPortaliQ8IYJ1.
SMRiQ8IYJ1. Positions 15-277.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini1 – 107107C2 1PROSITE-ProRule annotationAdd
BLAST
Domaini134 – 239106C2 2PROSITE-ProRule annotationAdd
BLAST
Domaini299 – 500202VWFAPROSITE-ProRule annotationAdd
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi262 – 2687Poly-Lys
Compositional biasi536 – 5416Poly-Pro

Sequence similaritiesi

Belongs to the copine family.Curated
Contains 2 C2 domains.PROSITE-ProRule annotation
Contains 1 VWFA domain.PROSITE-ProRule annotation

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiKOG1327. Eukaryota.
ENOG410XPC8. LUCA.
GeneTreeiENSGT00760000119085.
HOGENOMiHOG000220898.
HOVERGENiHBG066841.
InParanoidiQ8IYJ1.
OMAiDEDPNCV.
OrthoDBiEOG77DJ57.
PhylomeDBiQ8IYJ1.
TreeFamiTF316419.

Family and domain databases

Gene3Di2.60.40.150. 2 hits.
InterProiIPR000008. C2_dom.
IPR010734. Copine.
IPR002035. VWF_A.
[Graphical view]
PfamiPF00168. C2. 2 hits.
PF07002. Copine. 1 hit.
[Graphical view]
SMARTiSM00239. C2. 2 hits.
SM00327. VWA. 1 hit.
[Graphical view]
SUPFAMiSSF49562. SSF49562. 2 hits.
SSF53300. SSF53300. 1 hit.
PROSITEiPS50004. C2. 2 hits.
PS50234. VWFA. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8IYJ1-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSLGGASERS VPATKIEITV SCRNLLDLDT FSKSDPMVVL YTQSRASQEW
60 70 80 90 100
REFGRTEVID NTLNPDFVRK FVLDYFFEEK QNLRFDVYNV DSKTNISKPK
110 120 130 140 150
DFLGQAFLAL GEVIGGQGSR VERTLTGVPG KKCGTILLTA EELSNCRDIA
160 170 180 190 200
TMQLCANKLD KKDFFGKSDP FLVFYRSNED GTFTICHKTE VVKNTLNPVW
210 220 230 240 250
QPFSIPVRAL CNGDYDRTVK IDVYDWDRDG SHDFIGEFTT SYRELSKAQN
260 270 280 290 300
QFTVYEVLNP RKKCKKKKYV NSGTVTLLSF SVDSEFTFVD YIKGGTQLNF
310 320 330 340 350
TVAIDFTASN GNPLQPTSLH YMSPYQLSAY AMALKAVGEI IQDYDSDKLF
360 370 380 390 400
PAYGFGAKLP PEGRISHQFP LNNNDEDPNC AGIEGVLESY FQSLRTVQLY
410 420 430 440 450
GPTYFAPVIN QVARAAAKIS DGSQYYVLLI ITDGVISDMT QTKEAIVSAS
460 470 480 490 500
SLPMSIIIVG VGPAMFEAME ELDGDDVRVS SRGRYAERDI VQFVPFRDYV
510 520 530 540 550
DRSGNQVLSM ARLAKDVLAE IPEQLLSYMR TRDIQPRPPP PANPSPIPAP

EQP
Length:553
Mass (Da):61,864
Last modified:July 13, 2010 - v3
Checksum:iB57802E3DBFFF579
GO
Isoform 2 (identifier: Q8IYJ1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     493-553: FVPFRDYVDRSGNQVLSMARLAKDVLAEIPEQLLSYMRTRDIQPRPPPPANPSPIPAPEQP → EGCCSLGTSVV

Show »
Length:503
Mass (Da):56,034
Checksum:iB289BF825FE75602
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti100 – 1001Missing in EAW63970 (Ref. 2) Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei493 – 55361FVPFR…APEQP → EGCCSLGTSVV in isoform 2. 1 PublicationVSP_039523Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AC022382 Genomic DNA. No translation available.
CH471055 Genomic DNA. Translation: EAW63970.1.
BC130375 mRNA. Translation: AAI30376.1.
BC035735 mRNA. Translation: AAH35735.2.
CCDSiCCDS2574.2. [Q8IYJ1-1]
CCDS77695.1. [Q8IYJ1-2]
RefSeqiNP_001295317.1. NM_001308388.1.
NP_705899.2. NM_153635.2. [Q8IYJ1-1]
UniGeneiHs.121335.

Genome annotation databases

EnsembliENST00000383831; ENSP00000373342; ENSG00000144550. [Q8IYJ1-2]
ENST00000383832; ENSP00000373343; ENSG00000144550. [Q8IYJ1-1]
GeneIDi151835.
KEGGihsa:151835.
UCSCiuc062gli.1. human. [Q8IYJ1-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AC022382 Genomic DNA. No translation available.
CH471055 Genomic DNA. Translation: EAW63970.1.
BC130375 mRNA. Translation: AAI30376.1.
BC035735 mRNA. Translation: AAH35735.2.
CCDSiCCDS2574.2. [Q8IYJ1-1]
CCDS77695.1. [Q8IYJ1-2]
RefSeqiNP_001295317.1. NM_001308388.1.
NP_705899.2. NM_153635.2. [Q8IYJ1-1]
UniGeneiHs.121335.

3D structure databases

ProteinModelPortaliQ8IYJ1.
SMRiQ8IYJ1. Positions 15-277.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi127405. 1 interaction.
STRINGi9606.ENSP00000373343.

PTM databases

iPTMnetiQ8IYJ1.
PhosphoSiteiQ8IYJ1.

Polymorphism and mutation databases

BioMutaiCPNE9.
DMDMi300669696.

Proteomic databases

EPDiQ8IYJ1.
MaxQBiQ8IYJ1.
PaxDbiQ8IYJ1.
PeptideAtlasiQ8IYJ1.
PRIDEiQ8IYJ1.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000383831; ENSP00000373342; ENSG00000144550. [Q8IYJ1-2]
ENST00000383832; ENSP00000373343; ENSG00000144550. [Q8IYJ1-1]
GeneIDi151835.
KEGGihsa:151835.
UCSCiuc062gli.1. human. [Q8IYJ1-1]

Organism-specific databases

CTDi151835.
GeneCardsiCPNE9.
H-InvDBHIX0030823.
HGNCiHGNC:24336. CPNE9.
HPAiHPA049858.
neXtProtiNX_Q8IYJ1.
PharmGKBiPA142672082.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1327. Eukaryota.
ENOG410XPC8. LUCA.
GeneTreeiENSGT00760000119085.
HOGENOMiHOG000220898.
HOVERGENiHBG066841.
InParanoidiQ8IYJ1.
OMAiDEDPNCV.
OrthoDBiEOG77DJ57.
PhylomeDBiQ8IYJ1.
TreeFamiTF316419.

Miscellaneous databases

GenomeRNAii151835.
PROiQ8IYJ1.

Gene expression databases

BgeeiQ8IYJ1.
CleanExiHS_CPNE9.
ExpressionAtlasiQ8IYJ1. baseline and differential.
GenevisibleiQ8IYJ1. HS.

Family and domain databases

Gene3Di2.60.40.150. 2 hits.
InterProiIPR000008. C2_dom.
IPR010734. Copine.
IPR002035. VWF_A.
[Graphical view]
PfamiPF00168. C2. 2 hits.
PF07002. Copine. 1 hit.
[Graphical view]
SMARTiSM00239. C2. 2 hits.
SM00327. VWA. 1 hit.
[Graphical view]
SUPFAMiSSF49562. SSF49562. 2 hits.
SSF53300. SSF53300. 1 hit.
PROSITEiPS50004. C2. 2 hits.
PS50234. VWFA. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "The DNA sequence, annotation and analysis of human chromosome 3."
    Muzny D.M., Scherer S.E., Kaul R., Wang J., Yu J., Sudbrak R., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J.
    , Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R., Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Wei S., Wheeler D.A., Wright M.W., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clendenning J., Clerc-Blankenburg K.P., Chen R., Chen Z., Davis C., Delgado O., Dinh H.H., Dong W., Draper H., Ernst S., Fu G., Gonzalez-Garay M.L., Garcia D.K., Gillett W., Gu J., Hao B., Haugen E., Havlak P., He X., Hennig S., Hu S., Huang W., Jackson L.R., Jacob L.S., Kelly S.H., Kube M., Levy R., Li Z., Liu B., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Palmeiri A., Pasternak S., Perez L.M., Phelps K.A., Plopper F.J., Qiang B., Raymond C., Rodriguez R., Saenphimmachak C., Santibanez J., Shen H., Shen Y., Subramanian S., Tabor P.E., Verduzco D., Waldron L., Wang J., Wang J., Wang Q., Williams G.A., Wong G.K.-S., Yao Z., Zhang J., Zhang X., Zhao G., Zhou J., Zhou Y., Nelson D., Lehrach H., Reinhardt R., Naylor S.L., Yang H., Olson M., Weinstock G., Gibbs R.A.
    Nature 440:1194-1198(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
    Tissue: Brain.
  4. "Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry."
    Liu T., Qian W.-J., Gritsenko M.A., Camp D.G. II, Monroe M.E., Moore R.J., Smith R.D.
    J. Proteome Res. 4:2070-2080(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-95.
    Tissue: Plasma.
  5. "SYT14L, especially its C2 domain, is involved in regulating melanocyte differentiation."
    Yoo J.C., Lim T.Y., Park J.S., Hah Y.S., Park N., Hong S.G., Park J.Y., Yoon T.J.
    J. Dermatol. Sci. 72:246-251(2013) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, TISSUE SPECIFICITY.

Entry informationi

Entry nameiCPNE9_HUMAN
AccessioniPrimary (citable) accession number: Q8IYJ1
Secondary accession number(s): A1L430, A6NDX6, A8MSP8
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 6, 2007
Last sequence update: July 13, 2010
Last modified: July 6, 2016
This is version 94 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.