Q8IY17 (PLPL6_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 29, 2013.
Version 79.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Neuropathy target esterase EC=3.1.1.5 Alternative name(s): Patatin-like phospholipase domain-containing protein 6 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 1366 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Phospholipase B that deacylates intracellular phosphatidylcholine (PtdCho), generating glycerophosphocholine (GroPtdCho). This deacylation occurs at both sn-2 and sn-1 positions of PtdCho. Its specific chemical modification by certain organophosphorus (OP) compounds leads to distal axonopathy. Ref.7 Ref.8 |
| Catalytic activity | 2-lysophosphatidylcholine + H2O = glycerophosphocholine + a carboxylate. |
| Enzyme regulation | Inhibited by a series a OPs such as mipafox (MPX), phenyl saligenin phosphate (PSP), phenyl dipentyl phosphinate (PDPP), diisopropyl fluorophosphate and paraoxon. Ref.8 |
| Subcellular location | Endoplasmic reticulum membrane; Single-pass type I membrane protein; Cytoplasmic side. Note: Anchored to the cytoplasmic face of the endoplasmic reticulum by its amino-terminal transmembrane segment. Ref.8 |
| Tissue specificity | Expressed in brain, placenta, kidney, neuron and skeletal muscle. Ref.1 |
| Post-translational modification | Glycosylated. Ref.1 |
| Involvement in disease | Spastic paraplegia 39, autosomal recessive (SPG39) [MIM:612020]: A form of spastic paraplegia, a neurodegenerative disorder characterized by a slow, gradual, progressive weakness and spasticity of the lower limbs. Rate of progression and the severity of symptoms are quite variable. Initial symptoms may include difficulty with balance, weakness and stiffness in the legs, muscle spasms, and dragging the toes when walking. In some forms of the disorder, bladder symptoms (such as incontinence) may appear, or the weakness and stiffness may spread to other parts of the body. SPG39 is associated with a motor axonopathy affecting upper and lower limbs and resulting in progressive wasting of distal upper and lower extremity muscles. |
| Sequence similarities | Belongs to the NTE family. Contains 3 cyclic nucleotide-binding domains. Contains 1 patatin domain. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Lipid degradation Lipid metabolism |
| Cellular component | Endoplasmic reticulum Membrane |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Disease | Disease mutation Hereditary spastic paraplegia Neurodegeneration |
| Domain | Repeat Transmembrane Transmembrane helix |
| Molecular function | Hydrolase |
| PTM | Glycoprotein Phosphoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | cell death Inferred from electronic annotation. Source: UniProtKB-KW lipid catabolic processInferred from electronic annotation. Source: UniProtKB-KW phosphatidylcholine metabolic processInferred from electronic annotation. Source: InterPro |
| Cellular_component | endoplasmic reticulum membrane Inferred from electronic annotation. Source: UniProtKB-SubCell integral to membraneInferred from electronic annotation. Source: UniProtKB-KW |
| Molecular_function | lysophospholipase activity Inferred from electronic annotation. Source: EC |
| Complete GO annotation... | |
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q8IY17-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q8IY17-2) The sequence of this isoform differs from the canonical sequence as follows: 1-48: MGTSSHGLATNSSGAKVAERDGFQDVLAPGEGSAGRICGAQPVPFVPQ → MEAPLQTGM | ||||||
| Isoform 3 (identifier: Q8IY17-3) The sequence of this isoform differs from the canonical sequence as follows: 754-754: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 4 (identifier: Q8IY17-4) The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MEAPLQTGMM | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1366 | 1366 | Neuropathy target esterase | PRO_0000292199 | |||||
Regions | |||||||||
| Topological domain | 1 – 50 | 50 | Lumenal Potential | ||||||
| Transmembrane | 51 – 71 | 21 | Helical; Potential | ||||||
| Topological domain | 72 – 1366 | 1295 | Cytoplasmic Potential | ||||||
| Domain | 972 – 1138 | 167 | Patatin | ||||||
| Nucleotide binding | 186 – 313 | 128 | cNMP 1 | ||||||
| Nucleotide binding | 502 – 624 | 123 | cNMP 2 | ||||||
| Nucleotide binding | 620 – 740 | 121 | cNMP 3 | ||||||
| Motif | 1003 – 1007 | 5 | GXSXG | ||||||
Sites | |||||||||
| Active site | 1005 | 1 | By similarity | ||||||
Amino acid modifications | |||||||||
| Modified residue | 345 | 1 | Phosphoserine Ref.9 Ref.10 Ref.11 | ||||||
| Modified residue | 352 | 1 | Phosphothreonine Ref.10 | ||||||
| Modified residue | 353 | 1 | Phosphoserine Ref.10 | ||||||
| Glycosylation | 11 | 1 | N-linked (GlcNAc...) Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 48 | 48 | MGTSS…PFVPQ → MEAPLQTGM in isoform 2. | VSP_026388 | |||||
| Alternative sequence | 1 | 1 | M → MEAPLQTGMM in isoform 4. | VSP_046064 | |||||
| Alternative sequence | 754 | 1 | Missing in isoform 3. | VSP_026389 | |||||
| Natural variant | 403 | 1 | A → P. Ref.2 Ref.5 Corresponds to variant rs17854645 [ dbSNP | Ensembl ]. | VAR_032949 | |||||
| Natural variant | 929 | 1 | R → H in SPG39. Ref.13 | VAR_044409 | |||||
| Natural variant | 1024 | 1 | K → R. Ref.5 Corresponds to variant rs17854647 [ dbSNP | Ensembl ]. | VAR_032950 | |||||
| Natural variant | 1051 | 1 | M → V in SPG39. Ref.13 | VAR_044410 | |||||
Experimental info | |||||||||
| Sequence conflict | 34 – 37 | 4 | AGRI → TRPV in AAH38229. Ref.5 | ||||||
| Sequence conflict | 639 | 1 | T → A in BAG57380. Ref.2 | ||||||
| Sequence conflict | 705 | 1 | A → T in AAH38229. Ref.5 | ||||||
| Sequence conflict | 985 | 1 | I → W in CAB43674. Ref.6 | ||||||
| Sequence conflict | 1169 | 1 | W → V in CAB43674. Ref.6 | ||||||
| Sequence conflict | 1287 | 1 | E → G in CAB43674. Ref.6 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Neuropathy target esterase and a homologous Drosophila neurodegeneration-associated mutant protein contain a novel domain conserved from bacteria to man." Lush M.J., Li Y., Read D.J., Willis A.C., Glynn P. Biochem. J. 332:1-4(1998) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), GLYCOSYLATION, TISSUE SPECIFICITY. Tissue: Fetal brain. |
| [2] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4), VARIANT PRO-403. Tissue: Cerebellum. |
| [3] | "The DNA sequence and biology of human chromosome 19." Grimwood J., Gordon L.A., Olsen A.S., Terry A., Schmutz J., Lamerdin J.E., Hellsten U., Goodstein D., Couronne O., Tran-Gyamfi M., Aerts A., Altherr M., Ashworth L., Bajorek E., Black S., Branscomb E., Caenepeel S., Carrano A.V. Lucas S.M.Nature 428:529-535(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 34-1366 (ISOFORM 3), VARIANTS PRO-403 AND ARG-1024. Tissue: Brain, Duodenum and Testis. |
| [6] | "The full-ORF clone resource of the German cDNA consortium." Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I. BMC Genomics 8:399-399(2007) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 985-1366 (ISOFORMS 1/2). Tissue: Brain. |
| [7] | "The pathogenesis of organophosphate polyneuropathy." Lotti M. Crit. Rev. Toxicol. 21:465-487(1991) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION. |
| [8] | "Neuropathy target esterase and its yeast homologue degrade phosphatidylcholine to glycerophosphocholine in living cells." Zaccheo O., Dinsdale D., Meacock P.A., Glynn P. J. Biol. Chem. 279:24024-24033(2004) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, ENZYME REGULATION, SUBCELLULAR LOCATION. |
| [9] | "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle." Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M. Mol. Cell 31:438-448(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-345, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [10] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-345; THR-352 AND SER-353, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [11] | "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis." Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M. Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-345, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [12] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [13] | "Neuropathy target esterase gene mutations cause motor neuron disease." Rainier S., Bui M., Mark E., Thomas D., Tokarz D., Ming L., Delaney C., Richardson R.J., Albers J.W., Matsunami N., Stevens J., Coon H., Leppert M., Fink J.K. Am. J. Hum. Genet. 82:780-785(2008) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS SPG39 HIS-929 AND VAL-1051. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AJ004832 mRNA. Translation: CAA06164.1. AK294021 mRNA. Translation: BAG57380.1. AC008878 Genomic DNA. No translation available. AC009003 Genomic DNA. No translation available. CH471139 Genomic DNA. Translation: EAW69029.1. BC038229 mRNA. Translation: AAH38229.1. BC050553 mRNA. Translation: AAH50553.1. BC051768 mRNA. Translation: AAH51768.1. AL050362 mRNA. Translation: CAB43674.1. |
| IPI | IPI00217600. IPI00640818. IPI00940388. |
| RefSeq | NP_001159583.1. NM_001166111.1. NP_001159584.1. NM_001166112.1. NP_001159585.1. NM_001166113.1. NP_001159586.1. NM_001166114.1. NP_006693.3. NM_006702.4. |
| UniGene | Hs.631863. |
3D structure databases | |
| ProteinModelPortal | Q8IY17. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | 9606.ENSP00000221249. |
PTM databases | |
| PhosphoSite | Q8IY17. |
Polymorphism databases | |
| DMDM | 150403921. |
Proteomic databases | |
| PaxDb | Q8IY17. |
| PRIDE | Q8IY17. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000221249; ENSP00000221249; ENSG00000032444. ENST00000414982; ENSP00000407509; ENSG00000032444. ENST00000450331; ENSP00000394348; ENSG00000032444. ENST00000600737; ENSP00000473211; ENSG00000032444. |
| GeneID | 10908. |
| KEGG | hsa:10908. |
| UCSC | uc002mgq.2. human. uc002mgs.3. human. uc010xjq.2. human. |
Organism-specific databases | |
| CTD | 10908. |
| GeneCards | GC19P007506. |
| HGNC | HGNC:16268. PNPLA6. |
| HPA | HPA007522. |
| MIM | 603197. gene. 612020. phenotype. |
| neXtProt | NX_Q8IY17. |
| Orphanet | 139480. Autosomal recessive spastic paraplegia type 39. |
| PharmGKB | PA145148268. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | COG0664. |
| HOVERGEN | HBG053067. |
| InParanoid | Q8IY17. |
| KO | K14676. |
Gene expression databases | |
| ArrayExpress | Q8IY17. |
| Bgee | Q8IY17. |
| CleanEx | HS_PNPLA6. |
| Genevestigator | Q8IY17. |
Family and domain databases | |
| Gene3D | 2.60.120.10. 3 hits. |
| InterPro | IPR016035. Acyl_Trfase/lysoPLipase. IPR018490. cNMP-bd-like. IPR000595. cNMP-bd_dom. IPR001423. LysoPLipase_patatin_CS. IPR002641. Patatin/PLipase_A2-rel. IPR014710. RmlC-like_jellyroll. [Graphical view] |
| Pfam | PF00027. cNMP_binding. 3 hits. PF01734. Patatin. 1 hit. [Graphical view] |
| SMART | SM00100. cNMP. 3 hits. [Graphical view] |
| SUPFAM | SSF52151. Acyl_Trfase/lysoPlipase. 1 hit. SSF51206. cNMP_binding. 3 hits. |
| PROSITE | PS00888. CNMP_BINDING_1. False negative. PS00889. CNMP_BINDING_2. False negative. PS50042. CNMP_BINDING_3. 3 hits. PS01237. UPF0028. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 10908. |
| NextBio | 35535401. |
| SOURCE | Search... |
Entry information
| Entry name | PLPL6_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q8IY17 Secondary accession number(s): A6NGQ0 Q9UG58 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 19 Human chromosome 19: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
