Q8IXW5 (RPAP2_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 83.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Putative RNA polymerase II subunit B1 CTD phosphatase RPAP2 EC=3.1.3.16 Alternative name(s): RNA polymerase II-associated protein 2 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 612 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Protein phosphatase that displays CTD phosphatase activity and regulates transcription of snRNA genes. Recognizes and binds phosphorylated 'Ser-7' of the C-terminal heptapeptide repeat domain (CTD) of the largest RNA polymerase II subunit POLR2A, and mediates dephosphorylation of 'Ser-5' of the CTD, thereby promoting transcription of snRNA genes. Ref.4 Ref.8 |
| Catalytic activity | A phosphoprotein + H2O = a protein + phosphate. |
| Subunit structure | Associates with the RNA polymerase II complex. Interacts with transcribing RNA polymerase II phosphorylated on 'Ser-7' on CTD. Ref.4 Ref.7 |
| Subcellular location | Cytoplasm. Nucleus. Note: Shuttles between the cytoplasm and the nucleus in a CRM1-dependent manner. Ref.8 |
| Domain | The RTR1-type zinc finger mediates interactions with RNA polymerase II complex subunits (Ref.8). |
| Sequence similarities | Belongs to the RPAP2 family. Contains 1 RTR1-type zinc finger. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Transcription Transcription regulation |
| Cellular component | Cytoplasm Nucleus |
| Coding sequence diversity | Alternative splicing |
| Domain | Coiled coil Zinc-finger |
| Ligand | Metal-binding Zinc |
| Molecular function | Hydrolase Protein phosphatase |
| PTM | Phosphoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | dephosphorylation of RNA polymerase II C-terminal domain Inferred from mutant phenotype Ref.8. Source: UniProtKB snRNA transcriptionInferred from mutant phenotype Ref.8. Source: UniProtKB |
| Cellular_component | DNA-directed RNA polymerase II, holoenzyme Inferred from direct assay Ref.8Ref.7. Source: UniProtKB cytoplasmInferred from direct assay Ref.8. Source: UniProtKB |
| Molecular_function | CTD phosphatase activity Inferred from mutant phenotype Ref.8. Source: UniProtKB metal ion bindingInferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q8IXW5-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q8IXW5-2) The sequence of this isoform differs from the canonical sequence as follows: 563-596: LLTPILGIQKHSQEGMVFTRFLDTLLEELHLKNE → FLLNVKTRIKTFMMIYFHLMNS 597-612: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 612 | 612 | Putative RNA polymerase II subunit B1 CTD phosphatase RPAP2 | PRO_0000250648 | |||||
Regions | |||||||||
| Zinc finger | 77 – 160 | 84 | RTR1-type | ||||||
| Coiled coil | 33 – 68 | 36 | Potential | ||||||
Amino acid modifications | |||||||||
| Modified residue | 433 | 1 | Phosphoserine Ref.5 | ||||||
| Modified residue | 480 | 1 | Phosphoserine Ref.6 | ||||||
Natural variations | |||||||||
| Alternative sequence | 563 – 596 | 34 | LLTPI…HLKNE → FLLNVKTRIKTFMMIYFHLM NS in isoform 2. | VSP_020680 | |||||
| Alternative sequence | 597 – 612 | 16 | Missing in isoform 2. | VSP_020681 | |||||
Experimental info | |||||||||
| Mutagenesis | 100 | 1 | C → A: Abolishes interaction with RNA polymerase II complex subunits; when associated with A-105. Ref.8 | ||||||
| Mutagenesis | 105 | 1 | C → A: Abolishes interaction with RNA polymerase II complex subunits; when associated with A-100. Ref.8 | ||||||
| Mutagenesis | 136 | 1 | C → A: Abolishes interaction with RNA polymerase II complex subunits; when associated with A-140. Ref.8 | ||||||
| Mutagenesis | 140 | 1 | C → A: Abolishes interaction with RNA polymerase II complex subunits; when associated with A-136. Ref.8 | ||||||
| Sequence conflict | 421 | 1 | P → R in AAH31070. Ref.3 | ||||||
| Sequence conflict | 467 | 1 | Y → C in BAB14465. Ref.1 | ||||||
| Isoform 2: | |||||||||
| Sequence conflict | 584 | 1 | S → N in AAH31070. Ref.3 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). |
| [2] | "The DNA sequence and biological annotation of human chromosome 1." Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K. Bentley D.R.Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [3] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2). Tissue: Brain. |
| [4] | "Systematic analysis of the protein interaction network for the human transcription machinery reveals the identity of the 7SK capping enzyme." Jeronimo C., Forget D., Bouchard A., Li Q., Chua G., Poitras C., Therien C., Bergeron D., Bourassa S., Greenblatt J., Chabot B., Poirier G.G., Hughes T.R., Blanchette M., Price D.H., Coulombe B. Mol. Cell 27:262-274(2007) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, IDENTIFICATION BY MASS SPECTROMETRY, IDENTIFICATION IN THE RNA POLYMERASE II COMPLEX. |
| [5] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-433, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [6] | "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation." Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B. Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-480, MASS SPECTROMETRY. |
| [7] | "Control of the RNA polymerase II phosphorylation state in promoter regions by CTD interaction domain-containing proteins RPRD1A and RPRD1B." Ni Z., Olsen J.B., Guo X., Zhong G., Ruan E.D., Marcon E., Young P., Guo H., Li J., Moffat J., Emili A., Greenblatt J.F. Transcription 2:237-242(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION IN THE RNA POLYMERASE II COMPLEX. |
| [8] | "Ser7 phosphorylation of the CTD recruits the RPAP2 Ser5 phosphatase to snRNA genes." Egloff S., Zaborowska J., Laitem C., Kiss T., Murphy S. Mol. Cell 45:111-122(2012) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, SUBCELLULAR LOCATION, MUTAGENESIS OF CYS-100; CYS-105; CYS-136 AND CYS-140. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AK023212 mRNA. Translation: BAB14465.1. AL451010 Genomic DNA. Translation: CAH70763.1. BC031070 mRNA. Translation: AAH31070.1. BC039014 mRNA. Translation: AAH39014.1. |
| IPI | IPI00293375. IPI00787580. |
| RefSeq | NP_079089.2. NM_024813.2. |
| UniGene | Hs.444421. |
3D structure databases | |
| ProteinModelPortal | Q8IXW5. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q8IXW5. 3 interactions. |
| STRING | 9606.ENSP00000359368. |
PTM databases | |
| PhosphoSite | Q8IXW5. |
Polymorphism databases | |
| DMDM | 74750745. |
Proteomic databases | |
| PaxDb | Q8IXW5. |
| PRIDE | Q8IXW5. |
Protocols and materials databases | |
| DNASU | 79871. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000370343; ENSP00000359368; ENSG00000122484. |
| GeneID | 79871. |
| KEGG | hsa:79871. |
| UCSC | uc001dot.2. human. |
Organism-specific databases | |
| CTD | 79871. |
| GeneCards | GC01P092764. |
| HGNC | HGNC:25791. RPAP2. |
| HPA | HPA046443. |
| MIM | 611476. gene. |
| neXtProt | NX_Q8IXW5. |
| PharmGKB | PA162401981. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG241465. |
| HOGENOM | HOG000253960. |
| HOVERGEN | HBG080953. |
| InParanoid | Q8IXW5. |
| OMA | ECGKFIT. |
| OrthoDB | EOG44F69F. |
| PhylomeDB | Q8IXW5. |
Gene expression databases | |
| Bgee | Q8IXW5. |
| CleanEx | HS_RPAP2. |
| Genevestigator | Q8IXW5. |
| GermOnline | ENSG00000122484. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR007308. DUF408. [Graphical view] |
| Pfam | PF04181. RPAP2_Rtr1. 1 hit. [Graphical view] |
| PROSITE | PS51479. ZF_RTR1. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 79871. |
| NextBio | 69637. |
| SOURCE | Search... |
Entry information
| Entry name | RPAP2_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q8IXW5 Secondary accession number(s): C9JKB5, Q49AS7, Q9H8Y2 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Uncharacterized protein families (UPF) List of uncharacterized protein family (UPF) entries |
| Human chromosome 1 Human chromosome 1: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
