Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q8IXW5

- RPAP2_HUMAN

UniProt

Q8IXW5 - RPAP2_HUMAN

Protein

Putative RNA polymerase II subunit B1 CTD phosphatase RPAP2

Gene

RPAP2

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 94 (01 Oct 2014)
      Sequence version 1 (01 Mar 2003)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Protein phosphatase that displays CTD phosphatase activity and regulates transcription of snRNA genes. Recognizes and binds phosphorylated 'Ser-7' of the C-terminal heptapeptide repeat domain (CTD) of the largest RNA polymerase II subunit POLR2A, and mediates dephosphorylation of 'Ser-5' of the CTD, thereby promoting transcription of snRNA genes.2 Publications

    Catalytic activityi

    [a protein]-serine/threonine phosphate + H2O = [a protein]-serine/threonine + phosphate.

    Regions

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Zinc fingeri77 – 16084RTR1-typeAdd
    BLAST

    GO - Molecular functioni

    1. CTD phosphatase activity Source: UniProtKB
    2. metal ion binding Source: UniProtKB-KW

    GO - Biological processi

    1. dephosphorylation of RNA polymerase II C-terminal domain Source: UniProtKB
    2. snRNA transcription Source: UniProtKB

    Keywords - Molecular functioni

    Hydrolase, Protein phosphatase

    Keywords - Biological processi

    Transcription, Transcription regulation

    Keywords - Ligandi

    Metal-binding, Zinc

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Putative RNA polymerase II subunit B1 CTD phosphatase RPAP2 (EC:3.1.3.16)
    Alternative name(s):
    RNA polymerase II-associated protein 2
    Gene namesi
    Name:RPAP2
    Synonyms:C1orf82
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 1

    Organism-specific databases

    HGNCiHGNC:25791. RPAP2.

    Subcellular locationi

    Cytoplasm 1 Publication. Nucleus 1 Publication
    Note: Shuttles between the cytoplasm and the nucleus in a CRM1-dependent manner.

    GO - Cellular componenti

    1. cytoplasm Source: UniProtKB
    2. DNA-directed RNA polymerase II, holoenzyme Source: UniProtKB
    3. nucleolus Source: HPA
    4. nucleus Source: UniProtKB

    Keywords - Cellular componenti

    Cytoplasm, Nucleus

    Pathology & Biotechi

    Mutagenesis

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Mutagenesisi100 – 1001C → A: Abolishes interaction with RNA polymerase II complex subunits; when associated with A-105. 1 Publication
    Mutagenesisi105 – 1051C → A: Abolishes interaction with RNA polymerase II complex subunits; when associated with A-100. 1 Publication
    Mutagenesisi136 – 1361C → A: Abolishes interaction with RNA polymerase II complex subunits; when associated with A-140. 1 Publication
    Mutagenesisi140 – 1401C → A: Abolishes interaction with RNA polymerase II complex subunits; when associated with A-136. 1 Publication

    Organism-specific databases

    PharmGKBiPA162401981.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Initiator methioninei1 – 11Removed1 Publication
    Chaini2 – 612611Putative RNA polymerase II subunit B1 CTD phosphatase RPAP2PRO_0000250648Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei2 – 21N-acetylalanine1 Publication
    Modified residuei433 – 4331Phosphoserine1 Publication
    Modified residuei480 – 4801Phosphoserine1 Publication

    Keywords - PTMi

    Acetylation, Phosphoprotein

    Proteomic databases

    MaxQBiQ8IXW5.
    PaxDbiQ8IXW5.
    PRIDEiQ8IXW5.

    PTM databases

    PhosphoSiteiQ8IXW5.

    Expressioni

    Gene expression databases

    BgeeiQ8IXW5.
    CleanExiHS_RPAP2.
    GenevestigatoriQ8IXW5.

    Organism-specific databases

    HPAiHPA046443.

    Interactioni

    Subunit structurei

    Associates with the RNA polymerase II complex. Interacts with transcribing RNA polymerase II phosphorylated on 'Ser-7' on CTD.2 Publications

    Protein-protein interaction databases

    BioGridi122959. 48 interactions.
    IntActiQ8IXW5. 3 interactions.
    STRINGi9606.ENSP00000359368.

    Structurei

    3D structure databases

    ProteinModelPortaliQ8IXW5.
    SMRiQ8IXW5. Positions 53-174.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Coiled coil

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Coiled coili33 – 6836Sequence AnalysisAdd
    BLAST

    Domaini

    The RTR1-type zinc finger mediates interactions with RNA polymerase II complex subunits.1 Publication

    Sequence similaritiesi

    Belongs to the RPAP2 family.Curated
    Contains 1 RTR1-type zinc finger.Curated

    Zinc finger

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Zinc fingeri77 – 16084RTR1-typeAdd
    BLAST

    Keywords - Domaini

    Coiled coil, Zinc-finger

    Phylogenomic databases

    eggNOGiNOG241465.
    HOGENOMiHOG000253960.
    HOVERGENiHBG080953.
    InParanoidiQ8IXW5.
    OMAiIIFRTSC.
    OrthoDBiEOG7XWPQD.
    PhylomeDBiQ8IXW5.
    TreeFamiTF331431.

    Family and domain databases

    InterProiIPR007308. DUF408.
    [Graphical view]
    PfamiPF04181. RPAP2_Rtr1. 1 hit.
    [Graphical view]
    PROSITEiPS51479. ZF_RTR1. 1 hit.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q8IXW5-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MADFAGPSSA GRKAGAPRCS RKAAGTKQTS TLKQEDASKR KAELEAAVRK    50
    KIEFERKALH IVEQLLEENI TEEFLMECGR FITPAHYSDV VDERSIVKLC 100
    GYPLCQKKLG IVPKQKYKIS TKTNKVYDIT ERKSFCSNFC YQASKFFEAQ 150
    IPKTPVWVRE EERHPDFQLL KEEQSGHSGE EVQLCSKAIK TSDIDNPSHF 200
    EKQYESSSSS THSDSSSDNE QDFVSSILPG NRPNSTNIRP QLHQKSIMKK 250
    KAGHKANSKH KDKEQTVVDV TEQLGDCKLD SQEKDATCEL PLQKVNTQSS 300
    SNSTLPERLK ASENSESEYS RSEITLVGIS KKSAEHFKRK FAKSNQVSRS 350
    VSSSVQVCPE VGKRNLLKVL KETLIEWKTE ETLRFLYGQN YASVCLKPEA 400
    SLVKEELDED DIISDPDSHF PAWRESQNSL DESLPFRGSG TAIKPLPSYE 450
    NLKKETEKLN LRIREFYRGR YVLGEETTKS QDSEEHDSTF PLIDSSSQNQ 500
    IRKRIVLEKL SKVLPGLLVP LQITLGDIYT QLKNLVRTFR LTNRNIIHKP 550
    AEWTLIAMVL LSLLTPILGI QKHSQEGMVF TRFLDTLLEE LHLKNEDLES 600
    LTIIFRTSCL PE 612
    Length:612
    Mass (Da):69,509
    Last modified:March 1, 2003 - v1
    Checksum:i43D6DE7C30BB5C96
    GO
    Isoform 2 (identifier: Q8IXW5-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         563-596: LLTPILGIQKHSQEGMVFTRFLDTLLEELHLKNE → FLLNVKTRIKTFMMIYFHLMNS
         597-612: Missing.

    Show »
    Length:584
    Mass (Da):66,473
    Checksum:iC01259C16617931A
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti421 – 4211P → R in AAH31070. (PubMed:15489334)Curated
    Sequence conflicti467 – 4671Y → C in BAB14465. (PubMed:14702039)Curated
    Isoform 2 (identifier: Q8IXW5-2)
    Sequence conflicti584 – 5841S → N in AAH31070. (PubMed:15489334)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei563 – 59634LLTPI…HLKNE → FLLNVKTRIKTFMMIYFHLM NS in isoform 2. 1 PublicationVSP_020680Add
    BLAST
    Alternative sequencei597 – 61216Missing in isoform 2. 1 PublicationVSP_020681Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK023212 mRNA. Translation: BAB14465.1.
    AL451010 Genomic DNA. Translation: CAH70763.1.
    BC031070 mRNA. Translation: AAH31070.1.
    BC039014 mRNA. Translation: AAH39014.1.
    CCDSiCCDS740.1. [Q8IXW5-1]
    RefSeqiNP_079089.2. NM_024813.2. [Q8IXW5-1]
    UniGeneiHs.444421.

    Genome annotation databases

    EnsembliENST00000610020; ENSP00000476948; ENSG00000122484. [Q8IXW5-1]
    GeneIDi79871.
    KEGGihsa:79871.
    UCSCiuc001dot.2. human. [Q8IXW5-1]

    Polymorphism databases

    DMDMi74750745.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK023212 mRNA. Translation: BAB14465.1 .
    AL451010 Genomic DNA. Translation: CAH70763.1 .
    BC031070 mRNA. Translation: AAH31070.1 .
    BC039014 mRNA. Translation: AAH39014.1 .
    CCDSi CCDS740.1. [Q8IXW5-1 ]
    RefSeqi NP_079089.2. NM_024813.2. [Q8IXW5-1 ]
    UniGenei Hs.444421.

    3D structure databases

    ProteinModelPortali Q8IXW5.
    SMRi Q8IXW5. Positions 53-174.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 122959. 48 interactions.
    IntActi Q8IXW5. 3 interactions.
    STRINGi 9606.ENSP00000359368.

    PTM databases

    PhosphoSitei Q8IXW5.

    Polymorphism databases

    DMDMi 74750745.

    Proteomic databases

    MaxQBi Q8IXW5.
    PaxDbi Q8IXW5.
    PRIDEi Q8IXW5.

    Protocols and materials databases

    DNASUi 79871.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000610020 ; ENSP00000476948 ; ENSG00000122484 . [Q8IXW5-1 ]
    GeneIDi 79871.
    KEGGi hsa:79871.
    UCSCi uc001dot.2. human. [Q8IXW5-1 ]

    Organism-specific databases

    CTDi 79871.
    GeneCardsi GC01P092764.
    HGNCi HGNC:25791. RPAP2.
    HPAi HPA046443.
    MIMi 611476. gene.
    neXtProti NX_Q8IXW5.
    PharmGKBi PA162401981.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG241465.
    HOGENOMi HOG000253960.
    HOVERGENi HBG080953.
    InParanoidi Q8IXW5.
    OMAi IIFRTSC.
    OrthoDBi EOG7XWPQD.
    PhylomeDBi Q8IXW5.
    TreeFami TF331431.

    Miscellaneous databases

    GeneWikii RPAP2.
    GenomeRNAii 79871.
    NextBioi 69637.
    PROi Q8IXW5.
    SOURCEi Search...

    Gene expression databases

    Bgeei Q8IXW5.
    CleanExi HS_RPAP2.
    Genevestigatori Q8IXW5.

    Family and domain databases

    InterProi IPR007308. DUF408.
    [Graphical view ]
    Pfami PF04181. RPAP2_Rtr1. 1 hit.
    [Graphical view ]
    PROSITEi PS51479. ZF_RTR1. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    2. "The DNA sequence and biological annotation of human chromosome 1."
      Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K.
      , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
      Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
      Tissue: Brain.
    4. "Systematic analysis of the protein interaction network for the human transcription machinery reveals the identity of the 7SK capping enzyme."
      Jeronimo C., Forget D., Bouchard A., Li Q., Chua G., Poitras C., Therien C., Bergeron D., Bourassa S., Greenblatt J., Chabot B., Poirier G.G., Hughes T.R., Blanchette M., Price D.H., Coulombe B.
      Mol. Cell 27:262-274(2007) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, IDENTIFICATION BY MASS SPECTROMETRY, IDENTIFICATION IN THE RNA POLYMERASE II COMPLEX.
    5. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-433, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    6. "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
      Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
      Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-480, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    7. "Control of the RNA polymerase II phosphorylation state in promoter regions by CTD interaction domain-containing proteins RPRD1A and RPRD1B."
      Ni Z., Olsen J.B., Guo X., Zhong G., Ruan E.D., Marcon E., Young P., Guo H., Li J., Moffat J., Emili A., Greenblatt J.F.
      Transcription 2:237-242(2011) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION IN THE RNA POLYMERASE II COMPLEX.
    8. "Ser7 phosphorylation of the CTD recruits the RPAP2 Ser5 phosphatase to snRNA genes."
      Egloff S., Zaborowska J., Laitem C., Kiss T., Murphy S.
      Mol. Cell 45:111-122(2012) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, SUBCELLULAR LOCATION, MUTAGENESIS OF CYS-100; CYS-105; CYS-136 AND CYS-140.
    9. Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT ALA-2, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS], CLEAVAGE OF INITIATOR METHIONINE [LARGE SCALE ANALYSIS].

    Entry informationi

    Entry nameiRPAP2_HUMAN
    AccessioniPrimary (citable) accession number: Q8IXW5
    Secondary accession number(s): C9JKB5, Q49AS7, Q9H8Y2
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: October 3, 2006
    Last sequence update: March 1, 2003
    Last modified: October 1, 2014
    This is version 94 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 1
      Human chromosome 1: entries, gene names and cross-references to MIM
    2. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    3. SIMILARITY comments
      Index of protein domains and families
    4. Uncharacterized protein families (UPF)
      List of uncharacterized protein family (UPF) entries

    External Data

    Dasty 3