Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Putative RNA polymerase II subunit B1 CTD phosphatase RPAP2

Gene

RPAP2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Protein phosphatase that displays CTD phosphatase activity and regulates transcription of snRNA genes. Recognizes and binds phosphorylated 'Ser-7' of the C-terminal heptapeptide repeat domain (CTD) of the largest RNA polymerase II subunit POLR2A, and mediates dephosphorylation of 'Ser-5' of the CTD, thereby promoting transcription of snRNA genes.3 Publications

Catalytic activityi

[a protein]-serine/threonine phosphate + H2O = [a protein]-serine/threonine + phosphate.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Metal bindingi100ZincPROSITE-ProRule annotation1
Metal bindingi105ZincPROSITE-ProRule annotation1
Metal bindingi136ZincPROSITE-ProRule annotation1
Metal bindingi140ZincPROSITE-ProRule annotation1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri77 – 160RTR1-typePROSITE-ProRule annotationAdd BLAST84

GO - Molecular functioni

  • CTD phosphatase activity Source: UniProtKB
  • metal ion binding Source: UniProtKB-KW
  • protein serine/threonine phosphatase activity Source: Reactome

GO - Biological processi

  • dephosphorylation of RNA polymerase II C-terminal domain Source: UniProtKB
  • snRNA transcription Source: UniProtKB
  • snRNA transcription by RNA polymerase II Source: Reactome

Keywordsi

Molecular functionHydrolase, Protein phosphatase
Biological processTranscription, Transcription regulation
LigandMetal-binding, Zinc

Enzyme and pathway databases

ReactomeiR-HSA-6807505 RNA polymerase II transcribes snRNA genes
SIGNORiQ8IXW5

Names & Taxonomyi

Protein namesi
Recommended name:
Putative RNA polymerase II subunit B1 CTD phosphatase RPAP2 (EC:3.1.3.16)
Alternative name(s):
RNA polymerase II-associated protein 2
Gene namesi
Name:RPAP2
Synonyms:C1orf82
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

EuPathDBiHostDB:ENSG00000122484.8
HGNCiHGNC:25791 RPAP2
MIMi611476 gene
neXtProtiNX_Q8IXW5

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi100C → A: Abolishes interaction with RNA polymerase II complex subunits; when associated with A-105. 1 Publication1
Mutagenesisi105C → A: Abolishes interaction with RNA polymerase II complex subunits; when associated with A-100. 1 Publication1
Mutagenesisi136C → A: Abolishes interaction with RNA polymerase II complex subunits; when associated with A-140. 1 Publication1
Mutagenesisi140C → A: Abolishes interaction with RNA polymerase II complex subunits; when associated with A-136. 1 Publication1

Organism-specific databases

OpenTargetsiENSG00000122484
PharmGKBiPA162401981

Polymorphism and mutation databases

BioMutaiRPAP2
DMDMi74750745

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Initiator methionineiRemovedCombined sources
ChainiPRO_00002506482 – 612Putative RNA polymerase II subunit B1 CTD phosphatase RPAP2Add BLAST611

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei2N-acetylalanineCombined sources1
Modified residuei9PhosphoserineCombined sources1
Modified residuei216PhosphoserineBy similarity1
Modified residuei433PhosphoserineCombined sources1
Modified residuei480PhosphoserineCombined sources1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

EPDiQ8IXW5
MaxQBiQ8IXW5
PaxDbiQ8IXW5
PeptideAtlasiQ8IXW5
PRIDEiQ8IXW5

PTM databases

DEPODiQ8IXW5
iPTMnetiQ8IXW5
PhosphoSitePlusiQ8IXW5

Expressioni

Gene expression databases

BgeeiENSG00000122484
CleanExiHS_RPAP2
GenevisibleiQ8IXW5 HS

Organism-specific databases

HPAiHPA046443

Interactioni

Subunit structurei

Associates with the RNA polymerase II complex. Interacts with transcribing RNA polymerase II phosphorylated on 'Ser-7' on CTD.2 Publications

Binary interactionsi

Show more details

Protein-protein interaction databases

BioGridi122959, 84 interactors
DIPiDIP-32939N
IntActiQ8IXW5, 22 interactors
STRINGi9606.ENSP00000359368

Structurei

3D structure databases

ProteinModelPortaliQ8IXW5
SMRiQ8IXW5
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili33 – 68Sequence analysisAdd BLAST36

Domaini

The RTR1-type zinc finger mediates interactions with RNA polymerase II complex subunits.1 Publication

Sequence similaritiesi

Belongs to the RPAP2 family.Curated

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri77 – 160RTR1-typePROSITE-ProRule annotationAdd BLAST84

Keywords - Domaini

Coiled coil, Zinc-finger

Phylogenomic databases

eggNOGiKOG4780 Eukaryota
ENOG410ZZZC LUCA
GeneTreeiENSGT00390000017965
HOGENOMiHOG000253960
HOVERGENiHBG080953
InParanoidiQ8IXW5
KOiK20827
OMAiQYHISTR
OrthoDBiEOG091G0TLM
PhylomeDBiQ8IXW5
TreeFamiTF331431

Family and domain databases

Gene3Di1.25.40.820, 1 hit
InterProiView protein in InterPro
IPR007308 Rtr1/RPAP2
IPR038534 Rtr1/RPAP2_sf
PfamiView protein in Pfam
PF04181 RPAP2_Rtr1, 1 hit
PROSITEiView protein in PROSITE
PS51479 ZF_RTR1, 1 hit

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8IXW5-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MADFAGPSSA GRKAGAPRCS RKAAGTKQTS TLKQEDASKR KAELEAAVRK
60 70 80 90 100
KIEFERKALH IVEQLLEENI TEEFLMECGR FITPAHYSDV VDERSIVKLC
110 120 130 140 150
GYPLCQKKLG IVPKQKYKIS TKTNKVYDIT ERKSFCSNFC YQASKFFEAQ
160 170 180 190 200
IPKTPVWVRE EERHPDFQLL KEEQSGHSGE EVQLCSKAIK TSDIDNPSHF
210 220 230 240 250
EKQYESSSSS THSDSSSDNE QDFVSSILPG NRPNSTNIRP QLHQKSIMKK
260 270 280 290 300
KAGHKANSKH KDKEQTVVDV TEQLGDCKLD SQEKDATCEL PLQKVNTQSS
310 320 330 340 350
SNSTLPERLK ASENSESEYS RSEITLVGIS KKSAEHFKRK FAKSNQVSRS
360 370 380 390 400
VSSSVQVCPE VGKRNLLKVL KETLIEWKTE ETLRFLYGQN YASVCLKPEA
410 420 430 440 450
SLVKEELDED DIISDPDSHF PAWRESQNSL DESLPFRGSG TAIKPLPSYE
460 470 480 490 500
NLKKETEKLN LRIREFYRGR YVLGEETTKS QDSEEHDSTF PLIDSSSQNQ
510 520 530 540 550
IRKRIVLEKL SKVLPGLLVP LQITLGDIYT QLKNLVRTFR LTNRNIIHKP
560 570 580 590 600
AEWTLIAMVL LSLLTPILGI QKHSQEGMVF TRFLDTLLEE LHLKNEDLES
610
LTIIFRTSCL PE
Length:612
Mass (Da):69,509
Last modified:March 1, 2003 - v1
Checksum:i43D6DE7C30BB5C96
GO
Isoform 2 (identifier: Q8IXW5-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     563-596: LLTPILGIQKHSQEGMVFTRFLDTLLEELHLKNE → FLLNVKTRIKTFMMIYFHLMNS
     597-612: Missing.

Show »
Length:584
Mass (Da):66,473
Checksum:iC01259C16617931A
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti421P → R in AAH31070 (PubMed:15489334).Curated1
Sequence conflicti467Y → C in BAB14465 (PubMed:14702039).Curated1
Isoform 2 (identifier: Q8IXW5-2)
Sequence conflicti584S → N in AAH31070 (PubMed:15489334).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_020680563 – 596LLTPI…HLKNE → FLLNVKTRIKTFMMIYFHLM NS in isoform 2. 1 PublicationAdd BLAST34
Alternative sequenceiVSP_020681597 – 612Missing in isoform 2. 1 PublicationAdd BLAST16

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK023212 mRNA Translation: BAB14465.1
AL451010 Genomic DNA No translation available.
BC031070 mRNA Translation: AAH31070.1
BC039014 mRNA Translation: AAH39014.1
CCDSiCCDS740.1 [Q8IXW5-1]
RefSeqiNP_079089.2, NM_024813.2 [Q8IXW5-1]
UniGeneiHs.444421

Genome annotation databases

EnsembliENST00000610020; ENSP00000476948; ENSG00000122484 [Q8IXW5-1]
GeneIDi79871
KEGGihsa:79871
UCSCiuc001dot.3 human [Q8IXW5-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiRPAP2_HUMAN
AccessioniPrimary (citable) accession number: Q8IXW5
Secondary accession number(s): C9JKB5, Q49AS7, Q9H8Y2
Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 3, 2006
Last sequence update: March 1, 2003
Last modified: May 23, 2018
This is version 127 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families
  4. Uncharacterized protein families (UPF)
    List of uncharacterized protein family (UPF) entries

Cookie policy

We would like to use anonymized google analytics cookies to gather statistics on how uniprot.org is used in aggregate. Learn more

UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health