Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q8IXQ5 (KLHL7_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 105. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (7) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Kelch-like protein 7
Gene names
Name:KLHL7
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length586 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Substrate-specific adapter of a BCR (BTB-CUL3-RBX1) E3 ubiquitin ligase complex. The BCR(KLHL7) complex acts by mediating ubiquitination and subsequent degradation of substrate proteins. Probably mediates 'Lys-48'-linked ubiquitination. Ref.10

Pathway

Protein modification; protein ubiquitination.

Subunit structure

Homodimer. Component of the BCR(KLHL7) E3 ubiquitin ligase complex, at least composed of CUL3 and KLHL7 and RBX1. Ref.10

Subcellular location

Nucleus Ref.9.

Tissue specificity

Widely expressed, with highest levels in adult and fetal heart, CNS and adult testis. Ref.9

Involvement in disease

Retinitis pigmentosa 42 (RP42) [MIM:612943]: A retinal dystrophy belonging to the group of pigmentary retinopathies. Retinitis pigmentosa is characterized by retinal pigment deposits visible on fundus examination and primary loss of rod photoreceptor cells followed by secondary loss of cone photoreceptors. Patients typically have night vision blindness and loss of midperipheral visual field. As their condition progresses, they lose their far peripheral visual field and eventually central vision as well.
Note: The disease is caused by mutations affecting the gene represented in this entry. Ref.10 Ref.12 Ref.13 Ref.14

Sequence similarities

Contains 1 BACK (BTB/Kelch associated) domain.

Contains 1 BTB (POZ) domain.

Contains 6 Kelch repeats.

Ontologies

Alternative products

This entry describes 5 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q8IXQ5-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q8IXQ5-2)

The sequence of this isoform differs from the canonical sequence as follows:
     1-40: MAASGVEKSSKKKTEKKLAAREEAKLLAGFMGVMNNMRKQ → MLGGTDCRTFLTSHINLK
Isoform 3 (identifier: Q8IXQ5-3)

The sequence of this isoform differs from the canonical sequence as follows:
     149-166: ISVLAECLDCPELKATAD → EAEKVDQSLPECGMLFTV
     167-586: Missing.
Isoform 4 (identifier: Q8IXQ5-4)

The sequence of this isoform differs from the canonical sequence as follows:
     1-40: MAASGVEKSSKKKTEKKLAAREEAKLLAGFMGVMNNMRKQ → MLGGTDCRTFLTSHINLK
     149-166: ISVLAECLDCPELKATAD → EAEKVDQSLPECGMLFTV
     167-586: Missing.
Isoform 5 (identifier: Q8IXQ5-5)

The sequence of this isoform differs from the canonical sequence as follows:
     1-48: Missing.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 586586Kelch-like protein 7
PRO_0000228988

Regions

Domain44 – 11168BTB
Domain146 – 248103BACK
Repeat294 – 33643Kelch 1
Repeat337 – 38246Kelch 2
Repeat383 – 43048Kelch 3
Repeat431 – 48151Kelch 4
Repeat483 – 52846Kelch 5
Repeat530 – 57546Kelch 6

Natural variations

Alternative sequence1 – 4848Missing in isoform 5.
VSP_046974
Alternative sequence1 – 4040MAASG…NMRKQ → MLGGTDCRTFLTSHINLK in isoform 2 and isoform 4.
VSP_038416
Alternative sequence149 – 16618ISVLA…KATAD → EAEKVDQSLPECGMLFTV in isoform 3 and isoform 4.
VSP_038417
Alternative sequence167 – 586420Missing in isoform 3 and isoform 4.
VSP_038418
Natural variant1501S → N in RP42. Ref.12 Ref.14
VAR_060672
Natural variant1531A → T in RP42; impairs interaction with CUL3 and ubiquitin ligase activity of the BCR(KLHL7) complex. Ref.10 Ref.12 Ref.14
VAR_060673
Natural variant1531A → V in RP42; impairs interaction with CUL3 and ubiquitin ligase activity of the BCR(KLHL7) complex. Ref.10 Ref.12 Ref.13 Ref.14
VAR_060674
Natural variant2551D → N in a patient with retinitis pigmentosa; uncertain pathological significance. Ref.12
VAR_060675
Natural variant4231H → Y. Ref.12
VAR_060676
Natural variant4721K → Q in a patient with retinitis pigmentosa; uncertain pathological significance. Ref.12
VAR_060677
Isoform 2:
Natural variant181K → R.
Corresponds to variant rs17147682 [ dbSNP | Ensembl ].

Experimental info

Sequence conflict851V → L in AAH39585. Ref.8
Sequence conflict1381K → R in BAB71175. Ref.3
Sequence conflict5071E → D in BAH12925. Ref.3

Secondary structure

............................................................. 586
Helix Strand Turn

Details...

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified October 17, 2006. Version 2.
Checksum: FA4ED8F1567AC7A8

FASTA58665,992
        10         20         30         40         50         60 
MAASGVEKSS KKKTEKKLAA REEAKLLAGF MGVMNNMRKQ KTLCDVILMV QERKIPAHRV 

        70         80         90        100        110        120 
VLAAASHFFN LMFTTNMLES KSFEVELKDA EPDIIEQLVE FAYTARISVN SNNVQSLLDA 

       130        140        150        160        170        180 
ANQYQIEPVK KMCVDFLKEQ VDASNCLGIS VLAECLDCPE LKATADDFIH QHFTEVYKTD 

       190        200        210        220        230        240 
EFLQLDVKRV THLLNQDTLT VRAEDQVYDA AVRWLKYDEP NRQPFMVDIL AKVRFPLISK 

       250        260        270        280        290        300 
NFLSKTVQAE PLIQDNPECL KMVISGMRYH LLSPEDREEL VDGTRPRRKK HDYRIALFGG 

       310        320        330        340        350        360 
SQPQSCRYFN PKDYSWTDIR CPFEKRRDAA CVFWDNVVYI LGGSQLFPIK RMDCYNVVKD 

       370        380        390        400        410        420 
SWYSKLGPPT PRDSLAACAA EGKIYTSGGS EVGNSALYLF ECYDTRTESW HTKPSMLTQR 

       430        440        450        460        470        480 
CSHGMVEANG LIYVCGGSLG NNVSGRVLNS CEVYDPATET WTELCPMIEA RKNHGLVFVK 

       490        500        510        520        530        540 
DKIFAVGGQN GLGGLDNVEY YDIKLNEWKM VSPMPWKGVT VKCAAVGSIV YVLAGFQGVG 

       550        560        570        580 
RLGHILEYNT ETDKWVANSK VRAFPVTSCL ICVVDTCGAN EETLET 

« Hide

Isoform 2 [UniParc].

Checksum: D5FFE152DEA3D63E
Show »

FASTA56463,601
Isoform 3 [UniParc].

Checksum: D48BE4F0B94F1386
Show »

FASTA16618,568
Isoform 4 [UniParc].

Checksum: 90CD7ACD869455D7
Show »

FASTA14416,177
Isoform 5 [UniParc].

Checksum: 8B7ABA54C28D56C1
Show »

FASTA53860,725

References

« Hide 'large scale' references
[1]Zhang W., He L., Wan T., Zhu X., Cao X.
Submitted (DEC-1998) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3).
[2]"Towards a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs."
Wiemann S., Weil B., Wellenreuther R., Gassenhuber J., Glassl S., Ansorge W., Boecher M., Bloecker H., Bauersachs S., Blum H., Lauber J., Duesterhoeft A., Beyer A., Koehrer K., Strack N., Mewes H.-W., Ottenwaelder B., Obermaier B. expand/collapse author list , Tampe J., Heubner D., Wambutt R., Korn B., Klein M., Poustka A.
Genome Res. 11:422-435(2001) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Brain.
[3]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 5).
[4]"The full-ORF clone resource of the German cDNA consortium."
Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I.
BMC Genomics 8:399-399(2007) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
Tissue: Testis.
[5]"The DNA sequence of human chromosome 7."
Hillier L.W., Fulton R.S., Fulton L.A., Graves T.A., Pepin K.H., Wagner-McPherson C., Layman D., Maas J., Jaeger S., Walker R., Wylie K., Sekhon M., Becker M.C., O'Laughlin M.D., Schaller M.E., Fewell G.A., Delehaunty K.D., Miner T.L. expand/collapse author list , Nash W.E., Cordes M., Du H., Sun H., Edwards J., Bradshaw-Cordum H., Ali J., Andrews S., Isak A., Vanbrunt A., Nguyen C., Du F., Lamar B., Courtney L., Kalicki J., Ozersky P., Bielicki L., Scott K., Holmes A., Harkins R., Harris A., Strong C.M., Hou S., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Leonard S., Rohlfing T., Rock S.M., Tin-Wollam A.-M., Abbott A., Minx P., Maupin R., Strowmatt C., Latreille P., Miller N., Johnson D., Murray J., Woessner J.P., Wendl M.C., Yang S.-P., Schultz B.R., Wallis J.W., Spieth J., Bieri T.A., Nelson J.O., Berkowicz N., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Bedell J.A., Mardis E.R., Clifton S.W., Chissoe S.L., Marra M.A., Raymond C., Haugen E., Gillett W., Zhou Y., James R., Phelps K., Iadanoto S., Bubb K., Simms E., Levy R., Clendenning J., Kaul R., Kent W.J., Furey T.S., Baertsch R.A., Brent M.R., Keibler E., Flicek P., Bork P., Suyama M., Bailey J.A., Portnoy M.E., Torrents D., Chinwalla A.T., Gish W.R., Eddy S.R., McPherson J.D., Olson M.V., Eichler E.E., Green E.D., Waterston R.H., Wilson R.K.
Nature 424:157-164(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[6]"Human chromosome 7: DNA sequence and biology."
Scherer S.W., Cheung J., MacDonald J.R., Osborne L.R., Nakabayashi K., Herbrick J.-A., Carson A.R., Parker-Katiraee L., Skaug J., Khaja R., Zhang J., Hudek A.K., Li M., Haddad M., Duggan G.E., Fernandez B.A., Kanematsu E., Gentles S. expand/collapse author list , Christopoulos C.C., Choufani S., Kwasnicka D., Zheng X.H., Lai Z., Nusskern D.R., Zhang Q., Gu Z., Lu F., Zeesman S., Nowaczyk M.J., Teshima I., Chitayat D., Shuman C., Weksberg R., Zackai E.H., Grebe T.A., Cox S.R., Kirkpatrick S.J., Rahman N., Friedman J.M., Heng H.H.Q., Pelicci P.G., Lo-Coco F., Belloni E., Shaffer L.G., Pober B., Morton C.C., Gusella J.F., Bruns G.A.P., Korf B.R., Quade B.J., Ligon A.H., Ferguson H., Higgins A.W., Leach N.T., Herrick S.R., Lemyre E., Farra C.G., Kim H.-G., Summers A.M., Gripp K.W., Roberts W., Szatmari P., Winsor E.J.T., Grzeschik K.-H., Teebi A., Minassian B.A., Kere J., Armengol L., Pujana M.A., Estivill X., Wilson M.D., Koop B.F., Tosi S., Moore G.E., Boright A.P., Zlotorynski E., Kerem B., Kroisel P.M., Petek E., Oscier D.G., Mould S.J., Doehner H., Doehner K., Rommens J.M., Vincent J.B., Venter J.C., Li P.W., Mural R.J., Adams M.D., Tsui L.-C.
Science 300:767-772(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[7]Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[8]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 4).
Tissue: Pancreas and Skin.
[9]"Detection of autoantibodies to the BTB-kelch protein KLHL7 in cancer sera."
Bredholt G., Storstein A., Haugen M., Krossnes B.K., Husebye E., Knappskog P., Vedeler C.A.
Scand. J. Immunol. 64:325-335(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
[10]"Ubiquitin ligase activity of Cul3-KLHL7 protein is attenuated by autosomal dominant retinitis pigmentosa causative mutation."
Kigoshi Y., Tsuruta F., Chiba T.
J. Biol. Chem. 286:33613-33621(2011) [PubMed] [Europe PMC] [Abstract]
Cited for: FUNCTION, IDENTIFICATION IN THE BCR(KLHL7) COMPLEX, HOMODIMERIZATION, CHARACTERIZATION OF VARIANTS VARIANTS RP42 THR-153 AND VAL-153.
[11]"Crystal structure of the KELCH domain of human KLHL7."
Structural genomics consortium (SGC)
Submitted (AUG-2009) to the PDB data bank
Cited for: X-RAY CRYSTALLOGRAPHY (1.63 ANGSTROMS) OF 283-586.
[12]"Mutations in a BTB-Kelch protein, KLHL7, cause autosomal-dominant retinitis pigmentosa."
Friedman J.S., Ray J.W., Waseem N., Johnson K., Brooks M.J., Hugosson T., Breuer D., Branham K.E., Krauth D.S., Bowne S.J., Sullivan L.S., Ponjavic V., Graense L., Khanna R., Trager E.H., Gieser L.M., Hughbanks-Wheaton D., Cojocaru R.I. expand/collapse author list , Ghiasvand N.M., Chakarova C.F., Abrahamson M., Goering H.H.H., Webster A.R., Birch D.G., Abecasis G.R., Fann Y., Bhattacharya S.S., Daiger S.P., Heckenlively J.R., Andreasson S., Swaroop A.
Am. J. Hum. Genet. 84:792-800(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: VARIANTS RP42 ASN-150; THR-153 AND VAL-153, VARIANTS ASN-255; TYR-423 AND GLN-472, VARIANT ARG-18 (ISOFORM 2).
[13]"Phenotype associated with mutation in the recently identified autosomal dominant retinitis pigmentosa KLHL7 gene."
Hugosson T., Friedman J.S., Ponjavic V., Abrahamson M., Swaroop A., Andreasson S.
Arch. Ophthalmol. 128:772-778(2010) [PubMed] [Europe PMC] [Abstract]
Cited for: VARIANT RP42 VAL-153.
[14]"Phenotypic characterization of 3 families with autosomal dominant retinitis pigmentosa due to mutations in KLHL7."
Wen Y., Locke K.G., Klein M., Bowne S.J., Sullivan L.S., Ray J.W., Daiger S.P., Birch D.G., Hughbanks-Wheaton D.K.
Arch. Ophthalmol. 129:1475-1482(2011) [PubMed] [Europe PMC] [Abstract]
Cited for: VARIANTS RP42 ASN-150; THR-153 AND VAL-153.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AF111113 mRNA. Translation: AAF27196.1.
AL136597 mRNA. Translation: CAB66532.1.
AK056390 mRNA. Translation: BAB71175.1.
AK299006 mRNA. Translation: BAH12925.1.
EF560731 mRNA. Translation: ABQ59041.1.
AC005082 Genomic DNA. No translation available.
AC006039 Genomic DNA. Translation: AAO21916.1.
AC073992 Genomic DNA. No translation available.
CH236948 Genomic DNA. Translation: EAL24261.1.
CH471073 Genomic DNA. Translation: EAW93770.1.
CH471073 Genomic DNA. Translation: EAW93773.1.
CH471073 Genomic DNA. Translation: EAW93774.1.
BC009555 mRNA. Translation: AAH09555.1.
BC039585 mRNA. Translation: AAH39585.1.
RefSeqNP_001026880.2. NM_001031710.2.
NP_001165899.1. NM_001172428.1.
NP_061334.4. NM_018846.4.
UniGeneHs.654817.

3D structure databases

PDBe
RCSB PDB
PDBj
EntryMethodResolution (Å)ChainPositionsPDBsum
3II7X-ray1.63A283-586[»]
ProteinModelPortalQ8IXQ5.
SMRQ8IXQ5. Positions 33-275, 290-577.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid121021. 6 interactions.
IntActQ8IXQ5. 1 interaction.
MINTMINT-4718705.
STRING9606.ENSP00000343273.

PTM databases

PhosphoSiteQ8IXQ5.

Polymorphism databases

DMDM116242609.

Proteomic databases

PaxDbQ8IXQ5.
PRIDEQ8IXQ5.

Protocols and materials databases

DNASU55975.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000322231; ENSP00000322958; ENSG00000122550. [Q8IXQ5-2]
ENST00000322275; ENSP00000323270; ENSG00000122550. [Q8IXQ5-3]
ENST00000339077; ENSP00000343273; ENSG00000122550. [Q8IXQ5-1]
ENST00000409689; ENSP00000386263; ENSG00000122550. [Q8IXQ5-5]
ENST00000410047; ENSP00000386999; ENSG00000122550. [Q8IXQ5-4]
ENST00000545443; ENSP00000442366; ENSG00000122550. [Q8IXQ5-2]
GeneID55975.
KEGGhsa:55975.
UCSCuc003svp.3. human. [Q8IXQ5-4]
uc003svq.3. human. [Q8IXQ5-3]
uc003svr.4. human. [Q8IXQ5-2]
uc003svs.4. human. [Q8IXQ5-1]

Organism-specific databases

CTD55975.
GeneCardsGC07P023145.
HGNCHGNC:15646. KLHL7.
HPAHPA029491.
HPA029492.
MIM611119. gene.
612943. phenotype.
neXtProtNX_Q8IXQ5.
Orphanet791. Retinitis pigmentosa.
PharmGKBPA38392.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG305745.
HOGENOMHOG000230816.
HOVERGENHBG106113.
InParanoidQ8IXQ5.
KOK10445.
OMASVEYYDI.
OrthoDBEOG7K0ZBN.
PhylomeDBQ8IXQ5.
TreeFamTF351653.

Enzyme and pathway databases

UniPathwayUPA00143.

Gene expression databases

ArrayExpressQ8IXQ5.
BgeeQ8IXQ5.
CleanExHS_KLHL7.
GenevestigatorQ8IXQ5.

Family and domain databases

Gene3D2.120.10.80. 1 hit.
3.30.710.10. 1 hit.
InterProIPR011705. BACK.
IPR000210. BTB/POZ-like.
IPR011333. BTB/POZ_fold.
IPR013069. BTB_POZ.
IPR017096. Kelch-like_gigaxonin-typ.
IPR015915. Kelch-typ_b-propeller.
IPR006652. Kelch_1.
[Graphical view]
PfamPF07707. BACK. 1 hit.
PF00651. BTB. 1 hit.
PF01344. Kelch_1. 3 hits.
[Graphical view]
PIRSFPIRSF037037. Kelch-like_protein_gigaxonin. 1 hit.
SMARTSM00875. BACK. 1 hit.
SM00225. BTB. 1 hit.
SM00612. Kelch. 4 hits.
[Graphical view]
SUPFAMSSF54695. SSF54695. 1 hit.
PROSITEPS50097. BTB. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

ChiTaRSKLHL7. human.
EvolutionaryTraceQ8IXQ5.
GeneWikiKLHL7.
GenomeRNAi55975.
NextBio61429.
PROQ8IXQ5.
SOURCESearch...

Entry information

Entry nameKLHL7_HUMAN
AccessionPrimary (citable) accession number: Q8IXQ5
Secondary accession number(s): A4D144 expand/collapse secondary AC list , B7Z5I9, G5E9G3, Q7Z765, Q96MV2, Q9BQF8, Q9UDQ9
Entry history
Integrated into UniProtKB/Swiss-Prot: March 21, 2006
Last sequence update: October 17, 2006
Last modified: April 16, 2014
This is version 105 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

PDB cross-references

Index of Protein Data Bank (PDB) cross-references

PATHWAY comments

Index of metabolic and biosynthesis pathways

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 7

Human chromosome 7: entries, gene names and cross-references to MIM